Search Antibody, Protein, and ELISA Kit Solutions

C1QTNF8 Antibody - C-terminal region (ARP68023_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP68023_P050-FITC Conjugated

ARP68023_P050-HRP Conjugated

ARP68023_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
C1QTNF8
NCBI Gene Id:
390664
Protein Name:
Complement C1q tumor necrosis factor-related protein 8
Swissprot Id:
P60827
Protein Accession #:
NP_997302
Nucleotide Accession #:
NM_207419
Alias Symbols:
CTRP8, UNQ5829
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
252
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1QTNF8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1QTNF8.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QTNF8
Predicted Species Reactivity:
Cow, Horse, Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Horse: 100%; Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: AQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-C1QTNF8 (ARP68023_P050) antibody is Catalog # AAP68023
Datasheets/Manuals:
Printable datasheet for anti-C1QTNF8 (ARP68023_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...