C1QC Antibody - middle region : HRP (ARP60065_P050-HRP)

Catalog No: ARP60065_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human C1QC
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C1QC (ARP60065_P050-HRP) antibody is Catalog # AAP60065
• Reference: N/A

Target Info

• Gene Symbol: C1QC
• Gene Full Name: complement component 1, q subcomponent, C chain
• Alias Symbols: C1QG, C1Q-C
• NCBI Gene Id: 714
• Protein Name: Complement C1q subcomponent subunit C
• Description of Target: This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene.
• Uniprot ID: P02747
• Protein Accession #: NP_758957.2
• Protein Size (# AA): 245
• Molecular Weight: 26 kDa
• Protein Interactions: FN1; APOA1; PTX3; FKBP2; C1QB; C1QA;