C1QC Antibody - middle region (ARP60065_P050)

Catalog No: ARP60065_P050

WB Suggested Anti-C1QC antibody Titration: 1 ug/mL
Sample Type: Human Ovary Tumor

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human C1QC
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C1QC (ARP60065_P050) antibody is Catalog # AAP60065
• Reference: N/A

Target Info

• Gene Symbol: C1QC
• Gene Full Name: complement component 1, q subcomponent, C chain
• Alias Symbols: C1QG, C1Q-C
• NCBI Gene Id: 714
• Protein Name: Complement C1q subcomponent subunit C
• Description of Target: This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene.
• Uniprot ID: P02747
• Protein Accession #: NP_758957.2
• Protein Size (# AA): 245
• Molecular Weight: 26 kDa
• Protein Interactions: FN1; APOA1; PTX3; FKBP2; C1QB; C1QA;