Search Antibody, Protein, and ELISA Kit Solutions

C1QC Antibody - middle region (ARP60065_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP60065_P050-FITC Conjugated

ARP60065_P050-HRP Conjugated

ARP60065_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
complement component 1, q subcomponent, C chain
NCBI Gene Id:
Protein Name:
Complement C1q subcomponent subunit C
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-110932 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene.
Protein Size (# AA):
Molecular Weight:
26 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1QC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1QC.
The immunogen is a synthetic peptide directed towards the middle region of Human C1QC
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-C1QC (ARP60065_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-C1QC (ARP60065_P050) antibody is Catalog # AAP60065
Printable datasheet for anti-C1QC (ARP60065_P050) antibody
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...