SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP89851_P050
Price: $0.00
SKU
ARP89851_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-C1QB (ARP89851_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse C1QB
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: INSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGN
Concentration0.5 mg/ml
Blocking PeptideFor anti-C1QB (ARP89851_P050) antibody is Catalog # AAP89851
Gene SymbolC1QB
Gene Full Namecomplement component 1, q subcomponent, beta polypeptide
Alias SymbolsAdia
NCBI Gene Id12260
Protein Namecomplement C1q subcomponent subunit B
Description of TargetC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Uniprot IDP14106
Protein Accession #NP_033907.1
Nucleotide Accession #NM_009777.2
Protein Size (# AA)253
Molecular Weight27 kDa
  1. What is the species homology for "C1QB Antibody - middle region (ARP89851_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "C1QB Antibody - middle region (ARP89851_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "C1QB Antibody - middle region (ARP89851_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C1QB Antibody - middle region (ARP89851_P050)"?

    This target may also be called "Adia" in publications.

  5. What is the shipping cost for "C1QB Antibody - middle region (ARP89851_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C1QB Antibody - middle region (ARP89851_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C1QB Antibody - middle region (ARP89851_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C1QB Antibody - middle region (ARP89851_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "C1QB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "C1QB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "C1QB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "C1QB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "C1QB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "C1QB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C1QB Antibody - middle region (ARP89851_P050)
Your Rating