Catalog No: ARP44297_P050
Price: $0.00
SKU
ARP44297_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-C1QB (ARP44297_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human C1QB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Horse: 82%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Concentration0.5 mg/ml
Blocking PeptideFor anti-C1QB (ARP44297_P050) antibody is Catalog # AAP44297 (Previous Catalog # AAPP26657)
SubunitB
ReferenceRoumenina,L.T., (2006) Biochemistry 45 (13), 4093-4104
Publications

Histopathological comparison of the onset of peri-implantitis and periodontitis in rats. Clin Oral Implants Res. 28, 163-170 (2017). 26804139

Kuramoto, A. et al. The formation of immune complexes is involved in the acute phase of periodontal destruction in rats. J. Periodontal Res. 47, 455-62 (2012). 22283745

Nagano, F. et al. Gram-positive bacteria as an antigen topically applied into gingival sulcus of immunized rat accelerates periodontal destruction. J. Periodontal Res. 48, 420-7 (2013). 23137272

Nakatsu, S. et al. Occlusal trauma accelerates attachment loss at the onset of experimental periodontitis in rats. J. Periodontal Res. (2013). doi:10.1111/jre.12109 23808820

The histopathological comparison on the destruction of the periodontal tissue between normal junctional epithelium and long junctional epithelium. J. Periodont. Res. 52, 74-82 (2017). 26957231

Yoshinaga, Y. et al. Topical application of lipopolysaccharide into gingival sulcus promotes periodontal destruction in rats immunized with lipopolysaccharide. J. Periodontal Res. 47, 674-80 (2012). 22582894

Gene SymbolC1QB
Gene Full NameComplement component 1, q subcomponent, B chain
Alias Symbols-
NCBI Gene Id713
Protein NameComplement C1q subcomponent subunit B
Description of TargetC1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q.
Uniprot IDP02746
Protein Accession #NP_000482
Nucleotide Accession #NM_000491
Protein Size (# AA)253
Molecular Weight27kDa
Protein InteractionsIL32; EED; FN1; EDA2R; RELA; MYOC; PTX3; C1R; HRG; DEFA1; C1QC; C1QA;
  1. What is the species homology for "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Horse".

  2. How long will it take to receive "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C1QB Antibody - C-terminal region (ARP44297_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C1QB Antibody - C-terminal region (ARP44297_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "C1QB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "C1QB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "C1QB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "C1QB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "C1QB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "C1QB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C1QB Antibody - C-terminal region (ARP44297_P050)
Your Rating
We found other products you might like!