Search Antibody, Protein, and ELISA Kit Solutions

C1QB Antibody - C-terminal region (ARP44297_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44297_P050-FITC Conjugated

ARP44297_P050-HRP Conjugated

ARP44297_P050-Biotin Conjugated

Gene Symbol:
C1QB
Official Gene Full Name:
Complement component 1, q subcomponent, B chain
NCBI Gene Id:
713
Protein Name:
Complement C1q subcomponent subunit B
Swissprot Id:
P02746
Protein Accession #:
NP_000482
Nucleotide Accession #:
NM_000491
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-105153, HPA052116
Description of Target:
C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q.
Protein Size (# AA):
253
Molecular Weight:
27kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1QB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1QB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human C1QB
Predicted Species Reactivity:
Dog, Horse, Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Horse: 82%; Human: 100%
Complete computational species homology data:
Anti-C1QB (ARP44297_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
IL32; EED; FN1; EDA2R; RELA; MYOC; PTX3; C1R; HRG; DEFA1; C1QC; C1QA;
Blocking Peptide:
For anti-C1QB (ARP44297_P050) antibody is Catalog # AAP44297 (Previous Catalog # AAPP26657)
Datasheets/Manuals:
Printable datasheet for anti-C1QB (ARP44297_P050) antibody
Subunit:
B
Additional Information:
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
Target Reference:
Roumenina,L.T., (2006) Biochemistry 45 (13), 4093-4104
Publications:

Kuramoto, A. et al. The formation of immune complexes is involved in the acute phase of periodontal destruction in rats. J. Periodontal Res. 47, 455-62 (2012). IHC, WB, Dog, Horse, Human 22283745

Nagano, F. et al. Gram-positive bacteria as an antigen topically applied into gingival sulcus of immunized rat accelerates periodontal destruction. J. Periodontal Res. 48, 420-7 (2013). IHC, WB, Dog, Horse, Human 23137272

Nakatsu, S. et al. Occlusal trauma accelerates attachment loss at the onset of experimental periodontitis in rats. J. Periodontal Res. 49, 314-22 (2014). IHC, WB, Dog, Horse, Human 23808820

Noguchi, S; Ukai, T; Kuramoto, A; Yoshinaga, Y; Nakamura, H; Takamori, Y; Yamashita, Y; Hara, Y; The histopathological comparison on the destruction of the periodontal tissue between normal junctional epithelium and long junctional epithelium. 52, 74-82 (2017). IHC, WB, Dog, Horse, Human 26957231

Takamori, Y; Atsuta, I; Nakamura, H; Sawase, T; Koyano, K; Hara, Y; Histopathological comparison of the onset of peri-implantitis and periodontitis in rats. 28, 163-170 (2017). IHC, WB, Dog, Horse, Human 26804139

Yoshinaga, Y. et al. Topical application of lipopolysaccharide into gingival sulcus promotes periodontal destruction in rats immunized with lipopolysaccharide. J. Periodontal Res. 47, 674-80 (2012). IHC, WB, Dog, Horse, Human 22582894

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...