C1QA Recombinant Protein (Mouse) (OPCA01492)

Catalog No: OPCA01492

C1qa Recombinant Protein (Mouse) (OPCA01492) in SDS-PAGE showing the molecular weight of approximately 39.5 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)
• Host: Mouse
• Reconstitution and Storage: We recommend that this briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/ml. We recommend to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Store working aliquots at 4°C for up to one week. Repeated freeze/thaw cycles are not recommended.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: Full of Length of Mature Protein: EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
• Source: E.coli
• Protein Range: 23-245 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
• Gene Symbol: C1qa
• Gene Full Name: complement component 1, q subcomponent, alpha polypeptide
• Alias Symbols: Adic;adiponectin c;AI255395;C1q;complement C1q subcomponent subunit A.
• NCBI Gene Id: 12259
• Protein Name: Complement C1q subcomponent subunit A
• Description of Target: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
• Uniprot ID: P98086
• Protein Accession #: NP_031598.2
  
• Nucleotide Accession #: NM_007572.2
• Protein Size (# AA): Recombinant
• Molecular Weight: 40 kDa