C1QA Antibody - N-terminal region (ARP60064_P050)

Catalog No: ARP60064_P050

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein is heavily glycosylated, hydroxylated, and crosslinks to a B chain protein C1QB (27 kDa process

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1QA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 85%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C1QA (ARP60064_P050) antibody is Catalog # AAP60064 (Previous Catalog # AAPP46219)
• Subunit: A
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Gene Symbol: C1QA
• Gene Full Name: Complement component 1, q subcomponent, A chain
• Alias Symbols: -
• NCBI Gene Id: 712
• Protein Name: Complement C1q subcomponent subunit A
• Description of Target: This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q.
• Uniprot ID: P02745
• Protein Accession #: NP_057075
• Nucleotide Accession #: NM_015991
• Protein Size (# AA): 245
• Molecular Weight: 26 kDa
• Protein Interactions: RAC1; SLC25A47; GNPNAT1; UBQLN1; UBQLN2; HIPK3; PIAS2; BAG6; SGTA; PPP1CC; APOA1; PPP1CA; PTX3; C1QBP; CSPG4; C1R; SFTPA1; HRG; FN1; DCN; CR1; C1S; CD93; C1QC; C1QB; COL2A1; APCS; CRP;