Search Antibody, Protein, and ELISA Kit Solutions

C1orf94 Antibody - C-terminal region (ARP69047_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP69047_P050-FITC Conjugated

ARP69047_P050-HRP Conjugated

ARP69047_P050-Biotin Conjugated

Gene Symbol:
C1orf94
NCBI Gene Id:
84970
Protein Name:
Uncharacterized protein C1orf94
Swissprot Id:
Q6P1W5
Protein Accession #:
NP_001128206
Nucleotide Accession #:
NM_001134734
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-371471 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
598
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1orf94.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1orf94.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf94
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: FAKICSKPKADPAVERHHLMEWSPGTKEPKKGQGSLFLSQWPQSQKDACG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
VPS37C; PLEKHB2; BANP; C1orf109; RBFOX1; CCHCR1; RBM47; OAZ3; IPO11; BOLA1; TNPO2; VENTX; GORASP2; RBFOX2; FAM168A; GSE1; R3HDM2; OIP5; RBPMS; TXNDC9; AKAP9; DAZAP2; MAGED1; YES1; TBX6; ATXN1; RAD51D; MAPK9; PRKAG1; ROR2; MEIS2; LMO2; HNRNPF; GRB2; DAB1;
Blocking Peptide:
For anti-C1orf94 (ARP69047_P050) antibody is Catalog # AAP69047
Datasheets/Manuals:
Printable datasheet for anti-C1orf94 (ARP69047_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...