Size:100 ul
$319.00
In stock
SKU
ARP43313_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43313_P050-FITC Conjugated

ARP43313_P050-HRP Conjugated

ARP43313_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-149706 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf166
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-C1orf166 (ARP43313_P050)
Peptide Sequence Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MUL1 (ARP43313_P050) antibody is Catalog # AAP43313 (Previous Catalog # AAPP11388)
Datasheets/Manuals Printable datasheet for anti-MUL1 (ARP43313_P050) antibody
Target Reference Zhang,H., (2008) Biochem. Biophys. Res. Commun. 366 (4), 898-904
Publications

Hooper, C. L., Paudyal, A., Dash, P. R. & Boateng, S. Y. Modulation of stretch-induced myocyte remodeling and gene expression by nitric oxide: a novel role for lipoma preferred partner in myofibrillogenesis. Am. J. Physiol. Heart Circ. Physiol. 304, H1302-13 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23504181

Gene Symbol MUL1
Official Gene Full Name Mitochondrial E3 ubiquitin protein ligase 1
Alias Symbols FLJ12875, RP11-401M16.2, GIDE, MAPL, MULAN, RNF218, C1orf166
NCBI Gene Id 79594
Protein Name Mitochondrial ubiquitin ligase activator of NFKB 1
Description of Target The function of C1orf166 remains unknown.
Swissprot Id Q969V5
Protein Accession # NP_078820
Nucleotide Accession # NM_024544
Protein Size (# AA) 352
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express C1orf166.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express C1orf166.
Protein Interactions UBE2L3; UBE2G2; UBE2E2; TRIM9; GABARAP; UBE2E3; MUL1; UBE2D2; UBC; TRAF2; APPBP2; TAP1; MAVS; UBE2D3; UBE2D1; TP53; AKT1; DNM1L; VPS26A; SUMO1; UBE2I; VPS35; UBE2U; UBE2W; UBE2D4; UBE2L6; UBE2E1;
Write Your Own Review
You're reviewing:C1orf166 Antibody - middle region (ARP43313_P050)
Your Rating