Search Antibody, Protein, and ELISA Kit Solutions

C1orf166 Antibody - middle region (ARP43313_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43313_P050-FITC Conjugated

ARP43313_P050-HRP Conjugated

ARP43313_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-149706 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human C1orf166
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-C1orf166 (ARP43313_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MUL1 (ARP43313_P050) antibody is Catalog # AAP43313 (Previous Catalog # AAPP11388)
Printable datasheet for anti-MUL1 (ARP43313_P050) antibody
Target Reference:
Zhang,H., (2008) Biochem. Biophys. Res. Commun. 366 (4), 898-904

Hooper, C. L., Paudyal, A., Dash, P. R. & Boateng, S. Y. Modulation of stretch-induced myocyte remodeling and gene expression by nitric oxide: a novel role for lipoma preferred partner in myofibrillogenesis. Am. J. Physiol. Heart Circ. Physiol. 304, H1302-13 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23504181

Gene Symbol:
Official Gene Full Name:
Mitochondrial E3 ubiquitin protein ligase 1
Alias Symbols:
FLJ12875, RP11-401M16.2, GIDE, MAPL, MULAN, RNF218, C1orf166
NCBI Gene Id:
Protein Name:
Mitochondrial ubiquitin ligase activator of NFKB 1
Description of Target:
The function of C1orf166 remains unknown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1orf166.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1orf166.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...