C1orf151 Antibody - middle region (ARP44801_P050)

Be the first to review this product

Catalog#: ARP44801_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human 293T

Human Liver Tumor

Human COLO205 Whole Cell

Click here to learn more about Aviva's By-Request Conjugation Service.

Size:	100 ul
Price:	$319.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP44801_P050-FITC Conjugated

ARP44801_P050-HRP Conjugated

ARP44801_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.

Tested Species Reactivity:: Human
Predicted Species Reactivity:: Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:: Polyclonal
Host:: Rabbit
Application:: WB
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:: MINOS1
Official Gene Full Name:: Mitochondrial inner membrane organizing system 1
NCBI Gene Id:: 440574
Protein Name:: Mitochondrial inner membrane organizing system protein 1
Swissprot Id:: Q5TGZ0
Protein Accession #:: NP_001027535
Nucleotide Accession #:: NM_001032363
Alias Symbols:: FLJ36999, MIO10, C1orf151, RP5-1056L3.2
Description of Target:: The exact function of C1orf151 remains unknown.
Protein Size (# AA):: 78
Molecular Weight:: 9kDa
Purification:: Affinity Purified
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express C1orf151.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express C1orf151.
Immunogen:: The immunogen is a synthetic peptide directed towards the middle region of human C1orf151
Predicted Homology Based on Immunogen Sequence:: Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:: Anti-C1orf151 (ARP44801_P050)
Peptide Sequence:: Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: MIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP;
Blocking Peptide:: For anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
Datasheets/Manuals:: Printable datasheet for anti-MINOS1 (ARP44801_P050) antibody

Target Reference:

Gregory,S.G., (2006) Nature 441 (7091), 315-321

Publications:

Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23676277

Stroud, DA; Surgenor, EE; Formosa, LE; Reljic, B; Frazier, AE; Dibley, MG; Osellame, LD; Stait, T; Beilharz, TH; Thorburn, DR; Salim, A; Ryan, MT; Accessory subunits are integral for assembly and function of human mitochondrial complex I. 538, 123-126 (2016). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27626371