C1orf151 Antibody - middle region (ARP44801_P050)

Size:100 ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Human 293T

Human Liver Tumor

Human COLO205 Whole Cell

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf151
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Complete computational species homology data: Anti-C1orf151 (ARP44801_P050)
• Peptide Sequence: Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
• Datasheets/Manuals: Printable datasheet for anti-MINOS1 (ARP44801_P050) antibody
• Target Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Publications:

  Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23676277

  Stroud, DA; Surgenor, EE; Formosa, LE; Reljic, B; Frazier, AE; Dibley, MG; Osellame, LD; Stait, T; Beilharz, TH; Thorburn, DR; Salim, A; Ryan, MT; Accessory subunits are integral for assembly and function of human mitochondrial complex I. 538, 123-126 (2016). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27626371

Target Info

• Gene Symbol: MINOS1
• Official Gene Full Name: Mitochondrial inner membrane organizing system 1
• Alias Symbols: FLJ36999, MIO10, C1orf151, RP5-1056L3.2
• NCBI Gene Id: 440574
• Protein Name: Mitochondrial inner membrane organizing system protein 1
• Description of Target: The exact function of C1orf151 remains unknown.
• Swissprot Id: Q5TGZ0
• Protein Accession #: NP_001027535
• Nucleotide Accession #: NM_001032363
• Protein Size (# AA): 78
• Molecular Weight: 9kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express C1orf151.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express C1orf151.
• Protein Interactions: MIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP;