Size:100 ul
$319.00
In stock
SKU
ARP44801_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44801_P050-FITC Conjugated

ARP44801_P050-HRP Conjugated

ARP44801_P050-Biotin Conjugated

C1orf151 Antibody - middle region (ARP44801_P050)

Catalog#: ARP44801_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityDog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C1orf151
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-C1orf151 (ARP44801_P050)
Peptide SequenceSynthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
Datasheets/ManualsPrintable datasheet for anti-MINOS1 (ARP44801_P050) antibody
Target ReferenceGregory,S.G., (2006) Nature 441 (7091), 315-321
Publications

Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23676277

Stroud, DA; Surgenor, EE; Formosa, LE; Reljic, B; Frazier, AE; Dibley, MG; Osellame, LD; Stait, T; Beilharz, TH; Thorburn, DR; Salim, A; Ryan, MT; Accessory subunits are integral for assembly and function of human mitochondrial complex I. 538, 123-126 (2016). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27626371

Gene SymbolMINOS1
Official Gene Full NameMitochondrial inner membrane organizing system 1
Alias SymbolsFLJ36999, MIO10, C1orf151, RP5-1056L3.2
NCBI Gene Id440574
Protein NameMitochondrial inner membrane organizing system protein 1
Description of TargetThe exact function of C1orf151 remains unknown.
Swissprot IdQ5TGZ0
Protein Accession #NP_001027535
Nucleotide Accession #NM_001032363
Protein Size (# AA)78
Molecular Weight9kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express C1orf151.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express C1orf151.
Protein InteractionsMIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP;
Write Your Own Review
You're reviewing:C1orf151 Antibody - middle region (ARP44801_P050)
Your Rating
Aviva Pathways
Aviva Blast Tool
Aviva Travel Grant
Aviva HIS tag Deal