Size:100 ul
$319.00
In Stock
SKU
ARP44801_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44801_P050-FITC Conjugated

ARP44801_P050-HRP Conjugated

ARP44801_P050-Biotin Conjugated

C1orf151 Antibody - middle region (ARP44801_P050)

Catalog#: ARP44801_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf151
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-C1orf151 (ARP44801_P050)
Peptide Sequence Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
Datasheets/Manuals Printable datasheet for anti-MINOS1 (ARP44801_P050) antibody
Target Reference Gregory,S.G., (2006) Nature 441 (7091), 315-321
Publications

Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23676277

Stroud, DA; Surgenor, EE; Formosa, LE; Reljic, B; Frazier, AE; Dibley, MG; Osellame, LD; Stait, T; Beilharz, TH; Thorburn, DR; Salim, A; Ryan, MT; Accessory subunits are integral for assembly and function of human mitochondrial complex I. 538, 123-126 (2016). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27626371

Gene Symbol MINOS1
Official Gene Full Name Mitochondrial inner membrane organizing system 1
Alias Symbols FLJ36999, MIO10, C1orf151, RP5-1056L3.2
NCBI Gene Id 440574
Protein Name Mitochondrial inner membrane organizing system protein 1
Description of Target The exact function of C1orf151 remains unknown.
Swissprot Id Q5TGZ0
Protein Accession # NP_001027535
Nucleotide Accession # NM_001032363
Protein Size (# AA) 78
Molecular Weight 9kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express C1orf151.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express C1orf151.
Protein Interactions MIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP;
  1. What is the species homology for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "C1orf151 Antibody - middle region (ARP44801_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C1orf151 Antibody - middle region (ARP44801_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    This target may also be called "FLJ36999, MIO10, C1orf151, RP5-1056L3.2" in publications.

  5. What is the shipping cost for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "9kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MINOS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MINOS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MINOS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MINOS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MINOS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MINOS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C1orf151 Antibody - middle region (ARP44801_P050)
Your Rating
We found other products you might like!