Search Antibody, Protein, and ELISA Kit Solutions

C1orf151 Antibody - middle region (ARP44801_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44801_P050-FITC Conjugated

ARP44801_P050-HRP Conjugated

ARP44801_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Mitochondrial inner membrane organizing system 1
NCBI Gene Id:
Protein Name:
Mitochondrial inner membrane organizing system protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ36999, MIO10, C1orf151, RP5-1056L3.2
Description of Target:
The exact function of C1orf151 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1orf151.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1orf151.
The immunogen is a synthetic peptide directed towards the middle region of human C1orf151
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-C1orf151 (ARP44801_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
Printable datasheet for anti-MINOS1 (ARP44801_P050) antibody
Target Reference:
Gregory,S.G., (2006) Nature 441 (7091), 315-321

Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23676277

Stroud, DA; Surgenor, EE; Formosa, LE; Reljic, B; Frazier, AE; Dibley, MG; Osellame, LD; Stait, T; Beilharz, TH; Thorburn, DR; Salim, A; Ryan, MT; Accessory subunits are integral for assembly and function of human mitochondrial complex I. 538, 123-126 (2016). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27626371

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...