Search Antibody, Protein, and ELISA Kit Solutions

C1orf144 antibody - N-terminal region (ARP55304_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55304_P050-FITC Conjugated

ARP55304_P050-HRP Conjugated

ARP55304_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Chromosome 1 open reading frame 144
Protein Name:
SUZ domain-containing protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp566C0424, MGC70432, C1orf144
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1orf144.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1orf144.
The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-C1orf144 (ARP55304_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SZRD1 (ARP55304_P050) antibody is Catalog # AAP55304 (Previous Catalog # AAPP33135)
Printable datasheet for anti-SZRD1 (ARP55304_P050) antibody
Sample Type Confirmation:

SZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...