Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

C1orf144 antibody - N-terminal region (ARP55304_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP55304_P050-FITC Conjugated

ARP55304_P050-HRP Conjugated

ARP55304_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SZRD1
NCBI Gene Id:
26099
Official Gene Full Name:
Chromosome 1 open reading frame 144
Protein Name:
SUZ domain-containing protein 1
Swissprot Id:
Q7Z422-4
Protein Accession #:
NP_056424
Nucleotide Accession #:
NM_015609
Alias Symbols:
DKFZp566C0424, MGC70432, C1orf144
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
133
Molecular Weight:
15kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C1orf144.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C1orf144.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144
Species Reactivity:
Cow, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-C1orf144 (ARP55304_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; P3H1; EHD4; NT5C2; MTMR2; ZPR1; SRP14; SRP9; ELAVL1;
Blocking Peptide:
For anti-SZRD1 (ARP55304_P050) antibody is Catalog # AAP55304 (Previous Catalog # AAPP33135)
Datasheets/Manuals:
Printable datasheet for anti-SZRD1 (ARP55304_P050) antibody
Sample Type Confirmation:

SZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Tell us what you think about this item!

Write A Review
    Please, wait...