C1D Antibody - middle region : HRP (ARP50534_P050-HRP)

Catalog No: ARP50534_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1D
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C1D (ARP50534_P050-HRP) antibody is Catalog # AAP50534 (Previous Catalog # AAPP13919)
• Reference: Schilders,G., (2007) Arthritis Rheum. 56 (7), 2449-2454

Target Info

• Gene Symbol: C1D
• Gene Full Name: C1D nuclear receptor corepressor
• Alias Symbols: LRP1, hC1D, Rrp47, SUNCOR, SUN-CoR
• NCBI Gene Id: 10438
• Protein Name: Nuclear nucleic acid-binding protein C1D
• Description of Target: C1D is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. C1D is thought to regulate TRAX/Translin complex formation. The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined.The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined.
• Uniprot ID: Q13901
• Protein Accession #: NP_006324
• Nucleotide Accession #: NM_006333
• Protein Size (# AA): 141
• Molecular Weight: 16kDa
• Protein Interactions: IL23R; UBC; NCOR2; NCOR1; NR1D1; THRB; THRA; APP; PCBD2; C1D; TSNAX; PRKDC;