SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54432_P050
Price: $0.00
SKU
ARP54432_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-C17orf97 (ARP54432_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolC17orf97
Gene Full Namechromosome 17 open reading frame 97
Alias SymbolsCK20, LIAT1
NCBI Gene Id400566
Protein NameUncharacterized protein C17orf97
Uniprot IDQ6ZQX7
Protein Accession #NP_001013694
Nucleotide Accession #NM_001013672
Protein Size (# AA)453
Molecular Weight50 kDa
Protein InteractionsSUMO1; NEDD8; JMJD6;
  1. What is the species homology for "C17orf97 Antibody (ARP54432_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse".

  2. How long will it take to receive "C17orf97 Antibody (ARP54432_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "C17orf97 Antibody (ARP54432_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C17orf97 Antibody (ARP54432_P050)"?

    This target may also be called "CK20, LIAT1" in publications.

  5. What is the shipping cost for "C17orf97 Antibody (ARP54432_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C17orf97 Antibody (ARP54432_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C17orf97 Antibody (ARP54432_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C17orf97 Antibody (ARP54432_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "C17ORF97"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "C17ORF97"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "C17ORF97"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "C17ORF97"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "C17ORF97"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "C17ORF97"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C17orf97 Antibody (ARP54432_P050)
Your Rating
We found other products you might like!