Catalog No: ARP53762_P050
Price: $0.00
SKU
ARP53762_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

C17orf39 Antibody - C-terminal region (ARP53762_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-GID4 (ARP53762_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
Concentration0.5 mg/ml
Blocking PeptideFor anti-GID4 (ARP53762_P050) antibody is Catalog # AAP53762 (Previous Catalog # AAPP30604)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceBi,W., (2002) Genome Res. 12 (5), 713-728
Gene SymbolGID4
Gene Full NameChromosome 17 open reading frame 39
Alias SymbolsVID2, VID24, C17orf39
NCBI Gene Id79018
Protein NameGlucose-induced degradation protein 4 homolog
Description of TargetThe exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Uniprot IDQ8IVV7
Protein Accession #NP_076957
Nucleotide Accession #NM_024052
Protein Size (# AA)300
Molecular Weight34 kDa
  1. What is the species homology for "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C17orf39 Antibody - C-terminal region (ARP53762_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    This target may also be called "VID2, VID24, C17orf39" in publications.

  5. What is the shipping cost for "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C17orf39 Antibody - C-terminal region (ARP53762_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GID4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GID4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GID4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GID4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GID4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GID4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C17orf39 Antibody - C-terminal region (ARP53762_P050)
Your Rating
We found other products you might like!