Search Antibody, Protein, and ELISA Kit Solutions

C17orf39 Antibody - C-terminal region (ARP53762_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53762_P050-FITC Conjugated

ARP53762_P050-HRP Conjugated

ARP53762_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GID4
Official Gene Full Name:
Chromosome 17 open reading frame 39
NCBI Gene Id:
79018
Protein Name:
Glucose-induced degradation protein 4 homolog
Swissprot Id:
Q8IVV7
Protein Accession #:
NP_076957
Nucleotide Accession #:
NM_024052
Alias Symbols:
MGC3048, C17orf39
Description of Target:
The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Protein Size (# AA):
300
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C17orf39.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C17orf39.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-C17orf39 (ARP53762_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GID4 (ARP53762_P050) antibody is Catalog # AAP53762 (Previous Catalog # AAPP30604)
Datasheets/Manuals:
Printable datasheet for anti-GID4 (ARP53762_P050) antibody
Target Reference:
Bi,W., (2002) Genome Res. 12 (5), 713-728

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...