C16orf78 Antibody - middle region (ARP52693_P050)

Catalog No: ARP52693_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-C16orf78 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf78
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C16orf78 (ARP52693_P050) antibody is Catalog # AAP52693 (Previous Catalog # AAPY03773)
• Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Target Info

• Gene Symbol: C16orf78
• Gene Full Name: Chromosome 16 open reading frame 78
• Alias Symbols: MGC33367
• NCBI Gene Id: 123970
• Protein Name: Uncharacterized protein C16orf78
• Description of Target: The exact function of C16orf78 remains unknown.
• Uniprot ID: Q8WTQ4
• Protein Accession #: NP_653203
• Nucleotide Accession #: NM_144602
• Protein Size (# AA): 265
• Molecular Weight: 34kDa
• Protein Interactions: SRPK2; SRPK1; UBC;