Catalog No: ARP52676_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP52676_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-C16orf71 (ARP52676_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C16orf71
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: KASACARKVPADTPQDTKEADSGSRCASRKQGSQAGPGPQLAQGMRLNAE
Concentration0.5 mg/ml
Blocking PeptideFor anti-C16orf71 (ARP52676_P050-Biotin) antibody is Catalog # AAP52676 (Previous Catalog # AAPY03756)
ReferenceStrausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Gene SymbolC16orf71
Gene Full NameChromosome 16 open reading frame 71
Alias SymbolsC16orf71
NCBI Gene Id146562
Protein NameUncharacterized protein C16orf71
Description of TargetThe exact function of C16orf71 remains unknown.
Uniprot IDQ8IYS4
Protein Accession #NP_631909
Nucleotide Accession #NM_139170
Protein Size (# AA)520
Molecular Weight56kDa
  1. What is the species homology for "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    This target may also be called "C16orf71" in publications.

  5. What is the shipping cost for "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "C16ORF71"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "C16ORF71"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "C16ORF71"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "C16ORF71"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "C16ORF71"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "C16ORF71"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C16orf71 Antibody - middle region : Biotin (ARP52676_P050-Biotin)
Your Rating
We found other products you might like!