C14ORF166 Recombinant Protein (Human) (OPCA04844)

Catalog No: OPCA04844

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
• Protein Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-244 aa
• Tag: N-terminal GST-tagged
• Reference: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000)

Target Info

• Gene Symbol: RTRAF
• Gene Full Name: RNA transcription, translation and transport factor
• Alias Symbols: C14orf166;CGI99;CGI-99;CLE;CLE7;CLE7 homolog;hCLE;hCLE1;LCRP369;RLL motif containing 1;RLLM1;RNA transcription, translation and transport factor protein;UPF0568 protein C14orf166.
• NCBI Gene Id: 51637
• Protein Name: RNA transcription, translation and transport factor protein
• Description of Target: RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264).
• Uniprot ID: Q9Y224
• Protein Accession #: NP_057123
• Nucleotide Accession #: NM_016039
• Protein Size (# AA): Recombinant
• Molecular Weight: 55.1 kDa