Search Antibody, Protein, and ELISA Kit Solutions

C12orf75 Antibody - N-terminal region (ARP69760_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP69760_P050-FITC Conjugated

ARP69760_P050-HRP Conjugated

ARP69760_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
C12orf75
NCBI Gene Id:
387882
Protein Name:
Overexpressed in colon carcinoma 1 protein
Swissprot Id:
Q8TAD7
Protein Accession #:
NP_001138671
Nucleotide Accession #:
NM_001145199
Alias Symbols:
AGD3, OCC-1, OCC1
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
63
Molecular Weight:
6kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C12orf75.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C12orf75.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf75
Predicted Species Reactivity:
Cow, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
Peptide Sequence:
Synthetic peptide located within the following region: QGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
REL; ELAVL1;
Blocking Peptide:
For anti-C12orf75 (ARP69760_P050) antibody is Catalog # AAP69760
Datasheets/Manuals:
Printable datasheet for anti-C12orf75 (ARP69760_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...