C12orf65 Antibody - C-terminal region (ARP68112_P050)

Catalog No: ARP68112_P050

Host: Rabbit
Target Name: C12orf65
Sample Type: Jurkat Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C12orf65
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: C12orf65
• Alias Symbols: SPG55, COXPD7, C12orf65
• NCBI Gene Id: 91574
• Protein Name: Probable peptide chain release factor C12orf65, mitochondrial
• Description of Target: This nuclear gene encodes a mitochondrial matrix protein that appears to contribute to peptide chain termination in the mitochondrial translation machinery. Two different 1 bp deletions (resulting in the same premature stop codon)result in decreased mitochondrial translation, decreased levels of oxidative phosphorylation complexes and encepthalomyopathy. Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q9H3J6
• Protein Accession #: NP_689482
• Nucleotide Accession #: NM_152269
• Protein Size (# AA): 166
• Molecular Weight: 18kDa
• Protein Interactions: UBC; CDK2; APP;