C11orf74 Antibody - middle region : HRP (ARP52634_P050-HRP)

Catalog No: ARP52634_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf74
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C11orf74 (ARP52634_P050-HRP) antibody is Catalog # AAP52634 (Previous Catalog # AAPY03715)

Target Info

• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Gene Symbol: C11orf74
• Gene Full Name: Chromosome 11 open reading frame 74
• Alias Symbols: NWC, HEPIS, C11orf74
• NCBI Gene Id: 119710
• Protein Name: Uncharacterized protein C11orf74
• Description of Target: The exact function of C11orf74 remains unknown.
• Uniprot ID: Q86VG3
• Protein Accession #: NP_620142
• Nucleotide Accession #: NM_138787
• Protein Size (# AA): 221
• Molecular Weight: 25kDa
• Protein Interactions: SMARCC2; SLC10A1; PPP1CC;