Search Antibody, Protein, and ELISA Kit Solutions

C10orf90 Antibody - C-terminal region (ARP68080_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP68080_P050-FITC Conjugated

ARP68080_P050-HRP Conjugated

ARP68080_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NCBI Gene Id:
Protein Name:
Centrosomal protein C10orf90
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FATS, bA422P15.2
Description of Target:
C10orf90 is a tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. It mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. It may have a role in the assembly of primary cilia.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C10orf90.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C10orf90.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C10orf90
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 85%; Human: 100%; Mouse: 79%; Rat: 86%
Peptide Sequence:
Synthetic peptide located within the following region: QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TP53; UBC;
Blocking Peptide:
For anti-C10orf90 (ARP68080_P050) antibody is Catalog # AAP68080
Printable datasheet for anti-C10orf90 (ARP68080_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...