Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OABB01771
Size:100UG
Price: $432.00
SKU
OABB01771
Availability: Domestic: within 1-2 week delivery | International: within 1-2 week delivery
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for C Antibody (OABB01771)
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityBovine|Human|Monkey|Rabbit
Product FormatLyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ClonalityPolyclonal
ClonePolyclonal
IsotypeRabbit IgG
HostRabbit
ApplicationWestern blot
Additional InformationNotes: WB: The detection limit for c-Myb is approximately 0.25ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
::Background: Myb proto-oncogene protein, also known as transcriptional activator Myb, is a protein that in humans is encoded by the MYB gene. It is a member of the MYB (myeloblastosis) family of transcription factors. This gene is mapped to 6q23.3.The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis, including the regulation of miR-155 in B-cells. MYB is also a critical target of MIR150.
Reconstitution and Storage2°C to 8°C|-20°C
ImmunogenE.coli-derived human c-Myb recombinant protein (Position: M1-E201). Human c-Myb shares 100% amino acid (aa) sequence identity with mouse c-Myb.
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQE
Concentration500 ug/ml
SpecificityNo cross reactivity with other proteins.
Application InfoWestern blot: 0.1-0.5 ug/ml: Human
Reference1. Chen Y, Xu H, Liu J, Zhang C, Leutz A, Mo X (Jul 2007). "The c-Myb functions as a downstream target of PDGF-mediated survival signal in vascular smooth muscle cells". Biochem Biophys Res Commun 360 (2): 433–6.
2. Xiao, C., Calado, D. P., Galler, G., Thai, T.-H., Patterson, H. C., Wang, J., Rajewsky, N., Bender, T. P., Rajewsky, K. MiR-150 controls B cell differentiation by targeting the transcription factor c-Myb. Cell 131: 146-159, 2007. Xiao, C., Calado, D. P., Galler, G., Thai, T.-H., Patterson, H. C., Wang, J., Rajewsky, N., Bender, T. P., Rajewsky, K. MiR-150 controls B cell differentiation by targeting the transcription factor c-Myb. Cell 131: 146-159, 2007.
3. Vargova K, Curik N, Burda P, Basova P, Kulvait V, Pospisil V, Savvulidi F, Kokavec J, Necas E, Berkova A, Obrtlikova P, Karban J, Mraz M, Pospisilova S, Mayer J, Trneny M, Zavadil J, Stopka T (April 2011). "MYB transcriptionally regulates the miR-155 host gene in chronic lymphocytic leukemia". Blood 117 (14): 3816–25.
Storage BufferEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
DescriptionRabbit IgG polyclonal antibody for Transcriptional activator Myb(MYB) detection. Tested with WB in Human.
Gene SymbolMYB
Gene Full NameMYB proto-oncogene, transcription factor
Alias Symbolsc-myb;Cmyb;c-myb_CDS;efg;oncogene AMV;proto-oncogene c-Myb;transcriptional activator Myb;v-myb avian myeloblastosis viral oncogene homolog.
NCBI Gene Id4602
Protein NameTranscriptional activator Myb
Description of TargetTranscriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.
Uniprot IDP10242
Molecular Weight72341 MW
  1. What is the species homology for "C Antibody (OABB01771)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Bovine|Human|Monkey|Rabbit".

  2. How long will it take to receive "C Antibody (OABB01771)"?

    This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".

  3. What buffer format is "C Antibody (OABB01771)" provided in?

    This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C Antibody (OABB01771)"?

    This target may also be called "c-myb;Cmyb;c-myb_CDS;efg;oncogene AMV;proto-oncogene c-Myb;transcriptional activator Myb;v-myb avian myeloblastosis viral oncogene homolog." in publications.

  5. What is the shipping cost for "C Antibody (OABB01771)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C Antibody (OABB01771)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C Antibody (OABB01771)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72341 MW".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C Antibody (OABB01771)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MYB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C Antibody (OABB01771)
Your Rating
We found other products you might like!