- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for C Antibody (OABB01771) |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Bovine|Human|Monkey|Rabbit |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Western blot |
Additional Information | Notes: WB: The detection limit for c-Myb is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: Myb proto-oncogene protein, also known as transcriptional activator Myb, is a protein that in humans is encoded by the MYB gene. It is a member of the MYB (myeloblastosis) family of transcription factors. This gene is mapped to 6q23.3.The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis, including the regulation of miR-155 in B-cells. MYB is also a critical target of MIR150. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E.coli-derived human c-Myb recombinant protein (Position: M1-E201). Human c-Myb shares 100% amino acid (aa) sequence identity with mouse c-Myb. |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQE |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human |
Reference | 1. Chen Y, Xu H, Liu J, Zhang C, Leutz A, Mo X (Jul 2007). "The c-Myb functions as a downstream target of PDGF-mediated survival signal in vascular smooth muscle cells". Biochem Biophys Res Commun 360 (2): 433–6. 2. Xiao, C., Calado, D. P., Galler, G., Thai, T.-H., Patterson, H. C., Wang, J., Rajewsky, N., Bender, T. P., Rajewsky, K. MiR-150 controls B cell differentiation by targeting the transcription factor c-Myb. Cell 131: 146-159, 2007. Xiao, C., Calado, D. P., Galler, G., Thai, T.-H., Patterson, H. C., Wang, J., Rajewsky, N., Bender, T. P., Rajewsky, K. MiR-150 controls B cell differentiation by targeting the transcription factor c-Myb. Cell 131: 146-159, 2007. 3. Vargova K, Curik N, Burda P, Basova P, Kulvait V, Pospisil V, Savvulidi F, Kokavec J, Necas E, Berkova A, Obrtlikova P, Karban J, Mraz M, Pospisilova S, Mayer J, Trneny M, Zavadil J, Stopka T (April 2011). "MYB transcriptionally regulates the miR-155 host gene in chronic lymphocytic leukemia". Blood 117 (14): 3816–25. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Transcriptional activator Myb(MYB) detection. Tested with WB in Human. |
Gene Symbol | MYB |
---|---|
Gene Full Name | MYB proto-oncogene, transcription factor |
Alias Symbols | c-myb;Cmyb;c-myb_CDS;efg;oncogene AMV;proto-oncogene c-Myb;transcriptional activator Myb;v-myb avian myeloblastosis viral oncogene homolog. |
NCBI Gene Id | 4602 |
Protein Name | Transcriptional activator Myb |
Description of Target | Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. |
Uniprot ID | P10242 |
Molecular Weight | 72341 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "C Antibody (OABB01771)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Bovine|Human|Monkey|Rabbit".
-
How long will it take to receive "C Antibody (OABB01771)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "C Antibody (OABB01771)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "C Antibody (OABB01771)"?
This target may also be called "c-myb;Cmyb;c-myb_CDS;efg;oncogene AMV;proto-oncogene c-Myb;transcriptional activator Myb;v-myb avian myeloblastosis viral oncogene homolog." in publications.
-
What is the shipping cost for "C Antibody (OABB01771)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "C Antibody (OABB01771)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "C Antibody (OABB01771)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "72341 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "C Antibody (OABB01771)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MYB"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MYB"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MYB"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MYB"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MYB"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MYB"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.