BYSL Antibody - middle region (ARP88684_P050)

Catalog No: ARP88684_P050

Host: Rabbit
Target Name: BYSL
Sample Tissue: Human MCF7 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BYSL
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BYSL (ARP88684_P050) antibody is Catalog # AAP88684

Target Info

• Gene Symbol: BYSL
• Gene Full Name: bystin like
• Alias Symbols: Enp1, BYSTIN
• NCBI Gene Id: 705
• Protein Name: bystin
• Description of Target: Bystin is expressed as a 2-kb major transcript and a 3.6-kb minor transcript in SNG-M cells and in human trophoblastic teratocarcinoma HT-H cells. Protein binding assays determined that bystin binds directly to trophinin and tastin, and that binding is enhanced when cytokeratins 8 and 18 are present. Immunocytochemistry of HT-H cells showed that bystin colocalizes with trophinin, tastin, and the cytokeratins, suggesting that these molecules form a complex in trophectoderm cells at the time of implantation. Using immunohistochemistry it was determined that trophinin and bystin are found in the placenta from the sixth week of pregnancy. Both proteins were localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the levels of trophinin, tastin, and bystin decreased and then disappeared from placental villi.
• Uniprot ID: Q13895
• Protein Accession #: NP_004044.3
• Nucleotide Accession #: NM_004053.3
• Protein Size (# AA): 437
• Molecular Weight: 48 kDa