BUXI Recombinant Protein (Orchid tree) (OPCA02842)

Catalog No: OPCA02842

BuXI Recombinant Protein (Bauhinia ungulata) (OPCA02842) in SDS-PAGE showing the molecular weight of approximately 21.2 kDa.

Product Info

• Predicted Species Reactivity: Bauhinia ungulata
• Product Format: Liquid or Lyophilized powder
• Host: Bauhinia ungulata
• Additional Information: Relevance: Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE
• Protein Sequence: DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-172 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Kinetic characterization of factor Xa binding using a quenched fluorescent substrate based on the reactive site of factor Xa inhibitor from Bauhinia ungulata seeds.Oliva M.L.V., Andrade S.A., Juliano M.A., Sallai R.C., Torquato R.J., Sampaio M.U., Pott V.J., Sampaio C.A.M.Curr. Med. Chem. 10:1085-1093(2003)
• Gene Symbol: BUXI
• Alias Symbols: Factor Xa inhibitor BuXI
• Protein Name: Factor Xa inhibitor BuXI
• Description of Target: Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa.
• Uniprot ID: P83594
• Protein Size (# AA): Recombinant
• Molecular Weight: 21.2 kDa