Btrc Antibody - C-terminal region (ARP42160_P050)

Catalog No: ARP42160_P050

WB Suggested Anti-Btrc Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Btrc (ARP42160_P050) antibody is Catalog # AAP42160 (Previous Catalog # AAPS11909)

Target Info

• Gene Symbol: Btrc
• Gene Full Name: Beta-transducin repeat containing protein
• Alias Symbols: Sl, HOS, FWD1, Fbw1, Fbw1a, Slimb, b-TrCP, beta-T, Beta-Tr, beta-TrCP, Beta-Trcp1, SCF b-TRCP, E3RSIkappaB, E3RS-IkappaB
• NCBI Gene Id: 12234
• Protein Name: F-box/WD repeat-containing protein 1A
• Description of Target: Btrc is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It recognizes and binds to phosphorylated target proteins. SCF(BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22'. SCF(BTRC) mediates the ubiquitination of phosphorylated NFKB1/nuclear factor NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5 and probably NFKB2. SCF(BTRC) mediates the ubiquitination of phosphorylated SNAI1.
• Uniprot ID: Q3ULA2
• Protein Accession #: NP_001032847
• Nucleotide Accession #: NM_001037758
• Protein Size (# AA): 605
• Molecular Weight: 69kDa
• Protein Interactions: ZRANB1; Tpx2; Taz; Per2; Cul1; Skp1a; Reg1; Stat1; Nfe2l2; Per1; Htt; Cops2; Ikbkb; Nkx3-2; Cdc25b; Nfkbia; Gli2;