Search Antibody, Protein, and ELISA Kit Solutions

BTNL3 Antibody - N-terminal region (ARP46769_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46769_P050-FITC Conjugated

ARP46769_P050-HRP Conjugated

ARP46769_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Horse, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
BTNL3
Official Gene Full Name:
Butyrophilin-like 3
NCBI Gene Id:
10917
Protein Name:
Butyrophilin-like protein 3
Swissprot Id:
Q6UXE8
Protein Accession #:
NP_932079
Nucleotide Accession #:
NM_197975
Alias Symbols:
BTNLR
Replacement Item:
This antibody may replace item sc-91733 from Santa Cruz Biotechnology.
Description of Target:
The specific function of BTNL3 is not yet known.
Protein Size (# AA):
466
Molecular Weight:
52kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BTNL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BTNL3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL3
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Horse: 77%; Human: 100%; Pig: 77%
Complete computational species homology data:
Anti-BTNL3 (ARP46769_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BTNL3 (ARP46769_P050) antibody is Catalog # AAP46769 (Previous Catalog # AAPP27568)
Datasheets/Manuals:
Printable datasheet for anti-BTNL3 (ARP46769_P050) antibody
Target Reference:
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 03:11
  • Overall Experience:
  • Quality:
293T cells in FC

Submitted by:
Iva Zlatareva
King’s College London

“The reagent has allowed me to detect the surface expression of BTNL3 on transduced cell lines.“

“It successfully labelled BTNL3 on the surface of live BTNL3-transduced 293T cells. Moreover, the antibody was specific for BTNL3 and there was minimal binding to the highly similar protein BTNL8.”

BTNL3

1. Primary antibody dilution: Serial dilution of 1.25-10ug/ml. Used to stain cells at 4C for 40min.

2. Secondary antibody and dilution: Donkey anti-rabbit AF647, 1:500. 30min at 4oC.

3. What controls were used in your experiment? transduced with empty vector or BTNL8.

4. How did you store the antibody after re-suspension? Antibody was aliquoted in PCR tubes at 2ul/tube and stored in -20C freezer.

5. How many different experimental trials were conducted using the antibody sample? N=3

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...