Size:100 ul
$289.00
In stock
SKU
ARP46769_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46769_P050-FITC Conjugated

ARP46769_P050-HRP Conjugated

ARP46769_P050-Biotin Conjugated

BTNL3 Antibody - N-terminal region (ARP46769_P050)

Rating:
80% of 100
Catalog#: ARP46769_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-91733 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 77%; Horse: 77%; Human: 100%; Pig: 77%
Complete computational species homology data Anti-BTNL3 (ARP46769_P050)
Peptide Sequence Synthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BTNL3 (ARP46769_P050) antibody is Catalog # AAP46769 (Previous Catalog # AAPP27568)
Datasheets/Manuals Printable datasheet for anti-BTNL3 (ARP46769_P050) antibody
Target Reference Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Gene Symbol BTNL3
Official Gene Full Name Butyrophilin-like 3
Alias Symbols BTNLR
NCBI Gene Id 10917
Protein Name Butyrophilin-like protein 3
Description of Target The specific function of BTNL3 is not yet known.
Swissprot Id Q6UXE8
Protein Accession # NP_932079
Nucleotide Accession # NM_197975
Protein Size (# AA) 466
Molecular Weight 52kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BTNL3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BTNL3.
Write Your Own Review
You're reviewing:BTNL3 Antibody - N-terminal region (ARP46769_P050)
Your Rating