SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP68011_P050
Price: $0.00
SKU
ARP68011_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

BTN2A3P Antibody - N-terminal region (ARP68011_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-BTN2A3P (ARP68011_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human BTN2A3P
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rabbit: 80%
Peptide SequenceSynthetic peptide located within the following region: SPAVFVYKGGRERTEEQKEEYRGRTTFVSKDSRGSVALIIHNVTAEDNGI
Concentration0.5 mg/ml
Blocking PeptideFor anti-BTN2A3P (ARP68011_P050) antibody is Catalog # AAP68011
Gene SymbolBTN2A3P
Alias SymbolsBTN2.3, BTN2A3
NCBI Gene Id54718
Protein NamePutative butyrophilin subfamily 2 member A3
Description of TargetThe butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A3) and BTN3 (e.g., BNT3A1; MIM 613593) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010
Uniprot IDQ96KV6
Protein Accession #NP_076923
Nucleotide Accession #NM_024018
Protein Size (# AA)586
Molecular Weight66kDa
Protein InteractionsDlg4;
  1. What is the species homology for "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rabbit".

  2. How long will it take to receive "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BTN2A3P Antibody - N-terminal region (ARP68011_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    This target may also be called "BTN2.3, BTN2A3" in publications.

  5. What is the shipping cost for "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BTN2A3P Antibody - N-terminal region (ARP68011_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BTN2A3P"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BTN2A3P"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BTN2A3P"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BTN2A3P"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BTN2A3P"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BTN2A3P"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BTN2A3P Antibody - N-terminal region (ARP68011_P050)
Your Rating