BTG2 Antibody - N-terminal region (ARP33560_P050)

Catalog No: ARP33560_P050

WB Suggested Anti-BTG2 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysateBTG2 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Host: Rabbit
Target Name: BTG2
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BTG2 (ARP33560_P050) antibody is Catalog # AAP33560 (Previous Catalog # AAPP04615)
• Sample Type Confirmation:

  BTG2 is strongly supported by BioGPS gene expression data to be expressed in ACHN

• Reference: Tsui,K.H., (2008) Prostate 68 (6), 610-619

Target Info

• Gene Symbol: BTG2
• Gene Full Name: BTG family, member 2
• Alias Symbols: PC3, APRO1, TIS21
• NCBI Gene Id: 7832
• Protein Name: Protein BTG2
• Description of Target: BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P78543
• Protein Accession #: NP_006754
• Nucleotide Accession #: NM_006763
• Protein Size (# AA): 158
• Molecular Weight: 17kDa
• Protein Interactions: CNOT7; CNOT8; SRA1; FBXL3; FBXW2; FBXW11; BTRC; CUL1; UBC; SKP2; SKP1; HMGN1; PRMT1; PICK1; SMAD9; SMAD1; PRKCA; HOXC8; HOXB9; DYT10; CNOT1; CNOT6L;