Size:100 ul
$319.00
In stock
SKU
ARP33561_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33561_P050-FITC Conjugated

ARP33561_P050-HRP Conjugated

ARP33561_P050-Biotin Conjugated

BTG2 Antibody - middle region (ARP33561_P050)

Catalog#: ARP33561_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130985 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BTG2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Sheep: 92%
Complete computational species homology data Anti-BTG2 (ARP33561_P050)
Peptide Sequence Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BTG2 (ARP33561_P050) antibody is Catalog # AAP33561 (Previous Catalog # AAPP04616)
Datasheets/Manuals Printable datasheet for anti-BTG2 (ARP33561_P050) antibody
Publications

Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23267836

Gene Symbol BTG2
Official Gene Full Name BTG family, member 2
Alias Symbols MGC126063, MGC126064, PC3, TIS21
NCBI Gene Id 7832
Protein Name Protein BTG2
Description of Target BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
Swissprot Id P78543
Protein Accession # NP_006754
Nucleotide Accession # NM_006763
Protein Size (# AA) 158
Molecular Weight 17kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BTG2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BTG2.
Protein Interactions CNOT7; CNOT8; SRA1; FBXL3; FBXW2; FBXW11; BTRC; CUL1; UBC; SKP2; SKP1; HMGN1; PRMT1; PICK1; SMAD9; SMAD1; PRKCA; HOXC8; HOXB9; DYT10; CNOT1; CNOT6L;
Write Your Own Review
You're reviewing:BTG2 Antibody - middle region (ARP33561_P050)
Your Rating