Search Antibody, Protein, and ELISA Kit Solutions

BTG2 antibody - middle region (ARP33561_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33561_P050-FITC Conjugated

ARP33561_P050-HRP Conjugated

ARP33561_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
BTG family, member 2
Protein Name:
Protein BTG2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC126063, MGC126064, PC3, TIS21
Replacement Item:
This antibody may replace item sc-130985 from Santa Cruz Biotechnology.
Description of Target:
BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BTG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BTG2.
The immunogen is a synthetic peptide directed towards the middle region of human BTG2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Sheep: 92%
Complete computational species homology data:
Anti-BTG2 (ARP33561_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BTG2 (ARP33561_P050) antibody is Catalog # AAP33561 (Previous Catalog # AAPP04616)
Printable datasheet for anti-BTG2 (ARP33561_P050) antibody

Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23267836

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...