Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP38015_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38015_T100-FITC Conjugated

ARP38015_T100-HRP Conjugated

ARP38015_T100-Biotin Conjugated

BTF3 Antibody - middle region (ARP38015_T100)

Catalog#: ARP38015_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-10057 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BTF3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Complete computational species homology dataAnti-BTF3 (ARP38015_T100)
Peptide SequenceSynthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-BTF3 (ARP38015_T100) antibody is Catalog # AAP38015 (Previous Catalog # AAPP20188)
Datasheets/ManualsPrintable datasheet for anti-BTF3 (ARP38015_T100) antibody
Sample Type Confirmation

BTF3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceOyake,T., et al., (2005) Gene 345 (2), 271-277
Publications

Thakur, D. et al. Human beta casein fragment (54-59) modulates M. bovis BCG survival and basic transcription factor 3 (BTF3) expression in THP-1 cell line. PLoS One 7, e45905 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23029305

Gene SymbolBTF3
Official Gene Full NameBasic transcription factor 3
Alias SymbolsNACB, BTF3a, BTF3b, BETA-NAC
NCBI Gene Id689
Protein NameTranscription factor BTF3
Description of TargetBTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Swissprot IdP20290
Protein Accession #NP_001032726
Nucleotide Accession #NM_001037637
Protein Size (# AA)206
Molecular Weight23kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BTF3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BTF3.
Protein InteractionsTXLNA; TXLNB; NACA; UBC; PDCD4; PPP2R1A; gag-pol; ESR1; CTNNB1; NACA2; RWDD4; PDRG1; RPL29; RPL11; APP; H2AFX; USP17L9P; POLR2B; MED21; CSNK2B;
Write Your Own Review
You're reviewing:BTF3 Antibody - middle region (ARP38015_T100)
Your Rating
Aviva Live Chat
Aviva Blast Tool
Aviva Pathways
Assay Development