Search Antibody, Protein, and ELISA Kit Solutions

BTF3 Antibody - middle region (ARP38015_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38015_T100-FITC Conjugated

ARP38015_T100-HRP Conjugated

ARP38015_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Basic transcription factor 3
NCBI Gene Id:
Protein Name:
Transcription factor BTF3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10057 from Santa Cruz Biotechnology.
Description of Target:
BTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BTF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BTF3.
The immunogen is a synthetic peptide directed towards the middle region of human BTF3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Complete computational species homology data:
Anti-BTF3 (ARP38015_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BTF3 (ARP38015_T100) antibody is Catalog # AAP38015 (Previous Catalog # AAPP20188)
Printable datasheet for anti-BTF3 (ARP38015_T100) antibody
Sample Type Confirmation:

BTF3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Oyake,T., et al., (2005) Gene 345 (2), 271-277

Thakur, D. et al. Human beta casein fragment (54-59) modulates M. bovis BCG survival and basic transcription factor 3 (BTF3) expression in THP-1 cell line. PLoS One 7, e45905 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23029305

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...