Catalog No: ARP38015_T100
Price: $0.00
SKU
ARP38015_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BTF3 (ARP38015_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BTF3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Concentration1.0 mg/ml
Blocking PeptideFor anti-BTF3 (ARP38015_T100) antibody is Catalog # AAP38015 (Previous Catalog # AAPP20188)
Sample Type Confirmation

BTF3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceOyake,T., et al., (2005) Gene 345 (2), 271-277
Publications

Thakur, D. et al. Human beta casein fragment (54-59) modulates M. bovis BCG survival and basic transcription factor 3 (BTF3) expression in THP-1 cell line. PLoS One 7, e45905 (2012). 23029305

Gene SymbolBTF3
Gene Full NameBasic transcription factor 3
Alias SymbolsNACB, BTF3a, BTF3b, BETA-NAC
NCBI Gene Id689
Protein NameTranscription factor BTF3
Description of TargetBTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Uniprot IDP20290
Protein Accession #NP_001032726
Nucleotide Accession #NM_001037637
Protein Size (# AA)206
Molecular Weight23kDa
Protein InteractionsTXLNA; TXLNB; NACA; UBC; PDCD4; PPP2R1A; gag-pol; ESR1; CTNNB1; NACA2; RWDD4; PDRG1; RPL29; RPL11; APP; H2AFX; USP17L9P; POLR2B; MED21; CSNK2B;
  1. What is the species homology for "BTF3 Antibody - middle region (ARP38015_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "BTF3 Antibody - middle region (ARP38015_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BTF3 Antibody - middle region (ARP38015_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BTF3 Antibody - middle region (ARP38015_T100)"?

    This target may also be called "NACB, BTF3a, BTF3b, BETA-NAC" in publications.

  5. What is the shipping cost for "BTF3 Antibody - middle region (ARP38015_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BTF3 Antibody - middle region (ARP38015_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BTF3 Antibody - middle region (ARP38015_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BTF3 Antibody - middle region (ARP38015_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BTF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BTF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BTF3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BTF3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BTF3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BTF3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BTF3 Antibody - middle region (ARP38015_T100)
Your Rating