BTF3 Antibody - middle region (ARP38015_T100)

Catalog No: ARP38015_T100

WB Suggested Anti-BTF3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateBTF3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BTF3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-BTF3 (ARP38015_T100) antibody is Catalog # AAP38015 (Previous Catalog # AAPP20188)
• Sample Type Confirmation:

  BTF3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Oyake,T., et al., (2005) Gene 345 (2), 271-277
• Publications:

  Thakur, D. et al. Human beta casein fragment (54-59) modulates M. bovis BCG survival and basic transcription factor 3 (BTF3) expression in THP-1 cell line. PLoS One 7, e45905 (2012). 23029305

Target Info

• Gene Symbol: BTF3
• Gene Full Name: Basic transcription factor 3
• Alias Symbols: NACB, BTF3a, BTF3b, BETA-NAC
• NCBI Gene Id: 689
• Protein Name: Transcription factor BTF3
• Description of Target: BTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
• Uniprot ID: P20290
• Protein Accession #: NP_001032726
• Nucleotide Accession #: NM_001037637
• Protein Size (# AA): 206
• Molecular Weight: 23kDa
• Protein Interactions: TXLNA; TXLNB; NACA; UBC; PDCD4; PPP2R1A; gag-pol; ESR1; CTNNB1; NACA2; RWDD4; PDRG1; RPL29; RPL11; APP; H2AFX; USP17L9P; POLR2B; MED21; CSNK2B;