Search Antibody, Protein, and ELISA Kit Solutions

BTF3 Antibody - middle region (ARP38015_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38015_T100-FITC Conjugated

ARP38015_T100-HRP Conjugated

ARP38015_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-10057 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human BTF3
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Complete computational species homology data:
Anti-BTF3 (ARP38015_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BTF3 (ARP38015_T100) antibody is Catalog # AAP38015 (Previous Catalog # AAPP20188)
Datasheets/Manuals:
Printable datasheet for anti-BTF3 (ARP38015_T100) antibody
Sample Type Confirmation:

BTF3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Oyake,T., et al., (2005) Gene 345 (2), 271-277
Publications:

Thakur, D. et al. Human beta casein fragment (54-59) modulates M. bovis BCG survival and basic transcription factor 3 (BTF3) expression in THP-1 cell line. PLoS One 7, e45905 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23029305

Gene Symbol:
BTF3
Official Gene Full Name:
Basic transcription factor 3
Alias Symbols:
NACB, BTF3a, BTF3b, BETA-NAC
NCBI Gene Id:
689
Protein Name:
Transcription factor BTF3
Description of Target:
BTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Swissprot Id:
P20290
Protein Accession #:
NP_001032726
Nucleotide Accession #:
NM_001037637
Protein Size (# AA):
206
Molecular Weight:
23kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BTF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BTF3.
Protein Interactions:
TXLNA; TXLNB; NACA; UBC; PDCD4; PPP2R1A; gag-pol; ESR1; CTNNB1; NACA2; RWDD4; PDRG1; RPL29; RPL11; APP; H2AFX; USP17L9P; POLR2B; MED21; CSNK2B;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...