BTBD2 Antibody - N-terminal region : FITC (ARP34458_P050-FITC)

Catalog No: ARP34458_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 90%
• Peptide Sequence: Synthetic peptide located within the following region: AFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BTBD2 (ARP34458_P050-FITC) antibody is Catalog # AAP34458 (Previous Catalog # AAPY00420)
• Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Target Info

• Gene Symbol: BTBD2
• Gene Full Name: BTB (POZ) domain containing 2
• Alias Symbols: -
• NCBI Gene Id: 55643
• Protein Name: BTB/POZ domain-containing protein 2
• Description of Target: The C-terminus of BTBD2 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.
• Uniprot ID: Q9BX70
• Protein Accession #: NP_060267
• Nucleotide Accession #: NM_017797
• Protein Size (# AA): 525
• Molecular Weight: 56kDa
• Protein Interactions: CUL3; TP53; ZNF512B; CDK2; SMAD2; KPNA2; RFWD2; COPS4; COPS3; TOP1; COPS5; COPS6; UBC; DPPA4; UBXN1; CCDC90B; RBM48; BRD7; IGSF21; UBR1; TRIM5; SETDB1; C14orf1; UNC119; CRMP1; GDF9; SMAD1; GBP2; TLE1; TGFBR1; PTN; GAPDH; EEF1A1;