Search Antibody, Protein, and ELISA Kit Solutions

BTBD15 Antibody - C-terminal region (ARP35874_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35874_P050-FITC Conjugated

ARP35874_P050-HRP Conjugated

ARP35874_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Zinc finger and BTB domain containing 44
NCBI Gene Id:
Protein Name:
Zinc finger and BTB domain-containing protein 44
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BTBD15, ZNF851, HSPC063
Replacement Item:
This antibody may replace item sc-102166 from Santa Cruz Biotechnology.
Description of Target:
Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BTBD15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BTBD15.
The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-BTBD15 (ARP35874_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128)
Printable datasheet for anti-ZBTB44 (ARP35874_P050) antibody
Target Reference:
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21887344

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...