BTBD15 Antibody - C-terminal region (ARP35874_P050)

Catalog#: ARP35874_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human HepG2

Size:	100 ul
Price:	Regular Price: $289.00 Special Price: $229.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP35874_P050-FITC Conjugated

ARP35874_P050-HRP Conjugated

ARP35874_P050-Biotin Conjugated

Tested Species Reactivity:: Human
Predicted Species Reactivity:: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:: Polyclonal
Host:: Rabbit
Application:: WB
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:: This antibody may replace item sc-102166 from Santa Cruz Biotechnology.
Immunogen:: The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15
Purification:: Affinity Purified
Predicted Homology Based on Immunogen Sequence:: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:: Anti-BTBD15 (ARP35874_P050)
Peptide Sequence:: Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:: For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128)
Datasheets/Manuals:: Printable datasheet for anti-ZBTB44 (ARP35874_P050) antibody
Target Reference:: Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications:: Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21887344
Gene Symbol:: ZBTB44
Official Gene Full Name:: Zinc finger and BTB domain containing 44
Alias Symbols:: BTBD15, ZNF851, HSPC063
NCBI Gene Id:: 29068
Protein Name:: Zinc finger and BTB domain-containing protein 44
Description of Target:: Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Swissprot Id:: Q86XX5
Protein Accession #:: NP_054874
Nucleotide Accession #:: NM_014155
Protein Size (# AA):: 467
Molecular Weight:: 52kDa
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express BTBD15.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express BTBD15.
Protein Interactions:: PSMA6; FAM124A; SMYD1; ZBTB44; WDFY3; POLI; GLRX3; AP1M1; RAD23A; SMURF2; SMAD7; SMAD1;