Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP35874_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35874_P050-FITC Conjugated

ARP35874_P050-HRP Conjugated

ARP35874_P050-Biotin Conjugated

BTBD15 Antibody - C-terminal region (ARP35874_P050)

Catalog#: ARP35874_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-102166 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data Anti-BTBD15 (ARP35874_P050)
Peptide Sequence Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128)
Datasheets/Manuals Printable datasheet for anti-ZBTB44 (ARP35874_P050) antibody
Target Reference Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications

Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21887344

Gene Symbol ZBTB44
Official Gene Full Name Zinc finger and BTB domain containing 44
Alias Symbols BTBD15, ZNF851, HSPC063
NCBI Gene Id 29068
Protein Name Zinc finger and BTB domain-containing protein 44
Description of Target Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Swissprot Id Q86XX5
Protein Accession # NP_054874
Nucleotide Accession # NM_014155
Protein Size (# AA) 467
Molecular Weight 52kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BTBD15.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BTBD15.
Protein Interactions PSMA6; FAM124A; SMYD1; ZBTB44; WDFY3; POLI; GLRX3; AP1M1; RAD23A; SMURF2; SMAD7; SMAD1;
Write Your Own Review
You're reviewing:BTBD15 Antibody - C-terminal region (ARP35874_P050)
Your Rating