BTBD15 Antibody - C-terminal region (ARP35874_P050)

Size:100 ul

Human HepG2

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-102166 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
• Complete computational species homology data: Anti-BTBD15 (ARP35874_P050)
• Peptide Sequence: Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128)
• Datasheets/Manuals: Printable datasheet for anti-ZBTB44 (ARP35874_P050) antibody
• Target Reference: Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Publications:

  Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21887344

Target Info

• Gene Symbol: ZBTB44
• Official Gene Full Name: Zinc finger and BTB domain containing 44
• Alias Symbols: BTBD15, ZNF851, HSPC063
• NCBI Gene Id: 29068
• Protein Name: Zinc finger and BTB domain-containing protein 44
• Description of Target: Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
• Swissprot Id: Q86XX5
• Protein Accession #: NP_054874
• Nucleotide Accession #: NM_014155
• Protein Size (# AA): 467
• Molecular Weight: 52kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express BTBD15.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express BTBD15.
• Protein Interactions: PSMA6; FAM124A; SMYD1; ZBTB44; WDFY3; POLI; GLRX3; AP1M1; RAD23A; SMURF2; SMAD7; SMAD1;