- Gene Symbol:
- ZBTB44
- NCBI Gene Id:
- 29068
- Official Gene Full Name:
- Zinc finger and BTB domain containing 44
- Protein Name:
- Zinc finger and BTB domain-containing protein 44
- Swissprot Id:
- Q86XX5
- Protein Accession #:
- NP_054874
- Nucleotide Accession #:
- NM_014155
- Alias Symbols:
- BTBD15, ZNF851, HSPC063
- Replacement Item:
- This antibody may replace item sc-102166 from Santa Cruz Biotechnology.
- Description of Target:
- Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
- Protein Size (# AA):
- 467
- Molecular Weight:
- 52kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express BTBD15.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express BTBD15.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
- Complete computational species homology data:
- Anti-BTBD15 (ARP35874_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- PSMA6; FAM124A; SMYD1; ZBTB44; WDFY3; POLI; GLRX3; AP1M1; RAD23A; SMURF2; SMAD7; SMAD1;
- Blocking Peptide:
- For anti-ZBTB44 (ARP35874_P050) antibody is Catalog # AAP35874 (Previous Catalog # AAPP07128)
- Datasheets/Manuals:
- Printable datasheet for anti-ZBTB44 (ARP35874_P050) antibody
- Target Reference:
- Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
- Publications:
Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21887344
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
