BTBD1 Antibody - N-terminal region (ARP34479_P050)

Catalog No: ARP34479_P050

WB Suggested Anti-BTBD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateBTBD1 is supported by BioGPS gene expression data to be expressed in 721_B

Host: Rabbit
Target Name: BTBD1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: BTBD1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: BTBD1
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BTBD1 (ARP34479_P050) antibody is Catalog # AAP34479 (Previous Catalog # AAPP23518)
• Sample Type Confirmation:

  BTBD1 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Target Info

• Gene Symbol: BTBD1
• Gene Full Name: BTB (POZ) domain containing 1
• Alias Symbols: C15orf1, NS5ATP8
• NCBI Gene Id: 53339
• Protein Name: BTB/POZ domain-containing protein 1
• Description of Target: The C-terminus of BTBD1 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: Q9H0C5
• Protein Accession #: NP_079514
• Nucleotide Accession #: NM_025238
• Protein Size (# AA): 482
• Molecular Weight: 53kDa
• Protein Interactions: CUL3; LRR1; FMOD; NEDD8; COPS4; COPS5; COPS3; UBC; TOP1; COPS6; CUL5; SUMO1; TRIM5;