- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-BRSK2 (ARP73774_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2 |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-BRSK2 (ARP73774_P050-FITC) antibody is Catalog # AAP73774 |
Gene Symbol | BRSK2 |
---|---|
Alias Symbols | SAD1, SADA, STK29, PEN11B, C11orf7 |
NCBI Gene Id | 9024 |
Description of Target | BRSK2 is a serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. It phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. It also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. It plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. It plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 is phosphorylated at Thr-174 can inhibit insulin secretion, BRSK2 is phosphorylated at Thr-260 can promote insulin secretion. It regulates reorganization of the actin cytoskeleton. It may play a role in the apoptotic response triggered by endoplasmatic reticulum (ER) stress. |
Uniprot ID | Q8IWQ3-5 |
Protein Size (# AA) | 766 |
Molecular Weight | 84kDa |
Protein Interactions | VCP; WEE1; UBC; CDC25C; CDC25B; FZR1; COPS5; PRKAA1; KBTBD7; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
This target may also be called "SAD1, SADA, STK29, PEN11B, C11orf7" in publications.
-
What is the shipping cost for "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "84kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BRSK2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BRSK2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BRSK2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BRSK2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BRSK2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BRSK2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.