Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

BRSK2 Antibody - middle region : FITC (ARP73774_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73774_P050 Unconjugated

ARP73774_P050-HRP Conjugated

ARP73774_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
BRSK2, C11orf7, PEN11B, SADA, STK29, HUSSY-12,
Replacement Item:
This antibody may replace item sc-130123 from Santa Cruz Biotechnology.
Description of Target:
BRSK2 is a serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. It phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. It also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. It plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. It plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 is phosphorylated at Thr-174 can inhibit insulin secretion, BRSK2 is phosphorylated at Thr-260 can promote insulin secretion. It regulates reorganization of the actin cytoskeleton. It may play a role in the apoptotic response triggered by endoplasmatic reticulum (ER) stress.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRSK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRSK2.
The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BRSK2 (ARP73774_P050-FITC) antibody is Catalog # AAP73774
Printable datasheet for anti-BRSK2 (ARP73774_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...