BRPF1 Antibody - middle region (ARP76720_P050)

Catalog No: ARP76720_P050

Host: Rabbit
Target Name: BRPF1
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BRPF1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKTAGPPKRPGRPPKNRESQM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BRPF1 (ARP76720_P050) antibody is Catalog # AAP76720

Target Info

• Gene Symbol: BRPF1
• Gene Full Name: bromodomain and PHD finger containing 1
• Alias Symbols: BR140, IDDDFP
• NCBI Gene Id: 7862
• Protein Name: peregrin
• Description of Target: This gene encodes a bromodomain, PHD finger and chromo/Tudor-related Pro-Trp-Trp-Pro (PWWP) domain containing protein. The encoded protein is a component of the MOZ/MORF histone acetyltransferase complexes which function as a transcriptional regulators. This protein binds to the catalytic MYST domains of the MOZ and MORF proteins and may play a role in stimulating acetyltransferase and transcriptional activity of the complex. Alternative splicing results in multiple transcript variants.
• Uniprot ID: P55201
• Protein Accession #: NP_001003694.1
• Nucleotide Accession #: NM_001003694.1
• Protein Size (# AA): 1214
• Molecular Weight: 133 kDa