Breast Tumor Kinase Antibody (Phospho-Tyr447) (OAAF07517)

Catalog No: OAAF07517 (Formerly GWB-ASB329)

Size:100 ug

Western blot analysis of lysates from 293 cells treated with EGF 200ng/ml 30', using Breast Tumor Kinase (Phospho-Tyr447) Antibody. The lane on the right is blocked with the phospho peptide.

Immunofluorescence analysis of NIH/3T3 cells, using Breast Tumor Kinase (Phospho-Tyr447) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot
• Additional Information: Modification Sites: Human:Y447
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human Breast Tumor Kinase around the phosphorylation site of Tyr447.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: AGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
• Concentration: 1mg/ml
• Specificity: Breast Tumor Kinase (Phospho-Tyr447) Antibody detects endogenous levels of Breast Tumor Kinase only when phosphorylated at Tyr447.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IF: 1:100~1:500
  ELISA: 1:1000

Target Info

• Gene Symbol: PTK6
• Gene Full Name: protein tyrosine kinase 6
• Alias Symbols: breast tumor kinase;BRK;protein-tyrosine kinase 6;protein-tyrosine kinase BRK;PTK6 protein tyrosine kinase 6;tyrosine-protein kinase BRK.
• NCBI Gene Id: 5753
• Protein Name: Protein-tyrosine kinase 6
• Description of Target: Non-receptor tyrosine-protein kinase implicated in the regulation of a variety of signaling pathways that control the differentiation and maintenance of normal epithelia, as well as tumor growth. Function seems to be context dependent and differ depending on cell type, as well as its intracellular localization. A number of potential nuclear and cytoplasmic substrates have been identified. These include the RNA-binding proteins: KHDRBS1/SAM68, KHDRBS2/SLM1, KHDRBS3/SLM2 and SFPQ/PSF; transcription factors: STAT3 and STAT5A/B and a variety of signaling molecules: ARHGAP35/p190RhoGAP, PXN/paxillin, BTK/ATK, STAP2/BKS. Associates also with a variety of proteins that are likely upstream of PTK6 in various signaling pathways, or for which PTK6 may play an adapter-like role. These proteins include ADAM15, EGFR, ERBB2, ERBB3 and IRS4. In normal or non-tumorigenic tissues, PTK6 promotes cellular differentiation and apoptosis. In tumors PTK6 contributes to cancer progression by sensitizing cells to mitogenic signals and enhancing proliferation, anchorage-independent survival and migration/invasion. Association with EGFR, ERBB2, ERBB3 may contribute to mammary tumor development and growth through enhancement of EGF-induced signaling via BTK/AKT and PI3 kinase. Contributes to migration and proliferation by contributing to EGF-mediated phosphorylation of ARHGAP35/p190RhoGAP, which promotes association with RASA1/p120RasGAP, inactivating RhoA while activating RAS. EGF stimulation resulted in phosphorylation of PNX/Paxillin by PTK6 and activation of RAC1 via CRK/CrKII, thereby promoting migration and invasion. PTK6 activates STAT3 and STAT5B to promote proliferation. Nuclear PTK6 may be important for regulating growth in normal epithelia, while cytoplasmic PTK6 might activate oncogenic signaling pathways.
• Uniprot ID: Q13882
• Molecular Weight: 51 kDa