Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP34803_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34803_T100-FITC Conjugated

ARP34803_T100-HRP Conjugated

ARP34803_T100-Biotin Conjugated

BRD9 Antibody - N-terminal region (ARP34803_T100)

Rating:
80% of 100
Catalog#: ARP34803_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-102170 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BRD9
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data Anti-BRD9 (ARP34803_T100)
Peptide Sequence Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BRD9 (ARP34803_T100) antibody is Catalog # AAP34803 (Previous Catalog # AAPP06011)
Datasheets/Manuals Printable datasheet for anti-BRD9 (ARP34803_T100) antibody
Sample Type Confirmation

BRD9 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Publications

Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22442726

Gene Symbol BRD9
Official Gene Full Name Bromodomain containing 9
Alias Symbols PRO9856, LAVS3040
NCBI Gene Id 65980
Protein Name Bromodomain-containing protein 9
Description of Target BRD9 is a member of protein family that contains bromodomain. It is potentially related to cancer.
Swissprot Id Q9H8M2
Protein Accession # NP_001009877
Nucleotide Accession # NM_001009877
Protein Size (# AA) 481
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BRD9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BRD9.
Protein Interactions CATIP; SUMO2;
Write Your Own Review
You're reviewing:BRD9 Antibody - N-terminal region (ARP34803_T100)
Your Rating