Search Antibody, Protein, and ELISA Kit Solutions

BRD7 Antibody - C-terminal region : FITC (ARP39018_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39018_P050 Unconjugated

ARP39018_P050-HRP Conjugated

ARP39018_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Bromodomain containing 7
NCBI Gene Id:
Protein Name:
Bromodomain-containing protein 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-131878 from Santa Cruz Biotechnology.
Description of Target:
BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRD7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRD7.
The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 86%
Complete computational species homology data:
Anti-BRD7 (ARP39018_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BRD7 (ARP39018_P050-FITC) antibody is Catalog # AAP39018 (Previous Catalog # AAPS03711)
Printable datasheet for anti-BRD7 (ARP39018_P050-FITC) antibody
Sample Type Confirmation:

BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat

FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Zhou,J., (2004) J. Cell. Physiol. 200 (1), 89-98

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...