Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

BRD7 Antibody - C-terminal region (ARP39018_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39018_P050-FITC Conjugated

ARP39018_P050-HRP Conjugated

ARP39018_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Bromodomain containing 7
NCBI Gene Id:
Protein Name:
Bromodomain-containing protein 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-131878 from Santa Cruz Biotechnology.
Description of Target:
BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRD7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRD7.
The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 86%
Complete computational species homology data:
Anti-BRD7 (ARP39018_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BRD7 (ARP39018_P050) antibody is Catalog # AAP39018 (Previous Catalog # AAPS03711)
Printable datasheet for anti-BRD7 (ARP39018_P050) antibody
Sample Type Confirmation:

BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Zhou,J., (2004) J. Cell. Physiol. 200 (1), 89-98

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...