Search Antibody, Protein, and ELISA Kit Solutions

BRD7 Antibody - C-terminal region (ARP39018_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39018_P050-FITC Conjugated

ARP39018_P050-HRP Conjugated

ARP39018_P050-Biotin Conjugated

Gene Symbol:
BRD7
Official Gene Full Name:
Bromodomain containing 7
NCBI Gene Id:
29117
Protein Name:
Bromodomain-containing protein 7
Swissprot Id:
Q9NPI1
Protein Accession #:
NP_037395
Nucleotide Accession #:
NM_013263
Alias Symbols:
BP75, CELTIX1, NAG4
Replacement Item:
This antibody may replace item sc-131878 from Santa Cruz Biotechnology.
Description of Target:
BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.
Protein Size (# AA):
651
Molecular Weight:
74kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRD7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRD7.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 86%
Complete computational species homology data:
Anti-BRD7 (ARP39018_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; Dvl1; HIST2H3C; BRD2; NEFL; BARD1; LRIF1; HAP1; TFAP4; TRIM24; SUMO2; SMARCE1; SMARCD1; SMARCC2; Bcl7b; CHD7; ARID2; RBFOX2; BCL7C; SMARCC1; SMARCA4; PCBD1; POU2F1; MYC; BRCA1; BHLHE40; HIST2H4A; HIST2H3A; BTBD2; RIF1; HNRNPUL1; HIST1H2AL; AGR2; PSMD
Blocking Peptide:
For anti-BRD7 (ARP39018_P050) antibody is Catalog # AAP39018 (Previous Catalog # AAPS03711)
Datasheets/Manuals:
Printable datasheet for anti-BRD7 (ARP39018_P050) antibody
Sample Type Confirmation:

BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Zhou,J., (2004) J. Cell. Physiol. 200 (1), 89-98

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...