Search Antibody, Protein, and ELISA Kit Solutions

BRD4 Antibody - C-terminal region (ARP39076_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39076_P050-FITC Conjugated

ARP39076_P050-HRP Conjugated

ARP39076_P050-Biotin Conjugated

Gene Symbol:
BRD4
Official Gene Full Name:
Bromodomain containing 4
NCBI Gene Id:
23476
Protein Name:
Bromodomain-containing protein 4
Swissprot Id:
O60885-2
Protein Accession #:
NP_055114
Nucleotide Accession #:
NM_014299
Alias Symbols:
CAP, HUNKI, MCAP, HUNK1
Replacement Item:
This antibody may replace item sc-141740 from Santa Cruz Biotechnology.
Description of Target:
BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
Protein Size (# AA):
722
Molecular Weight:
80kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
CHIP, IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRD4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRD4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-BRD4 (ARP39076_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AFF1; CDK9; CCNT1; STAT3; JMJD6; TCERG1; HEXIM1; RN7SK; PRPF40A; vif; RPL6; MYC; MLLT1; ELAVL1; SUMO2; UBC; YWHAZ; KAT8; C8orf33; MESDC2; HIST1H4A; HIST1H3A; YWHAE; MED1; EP300; KDM5B; C7orf25; CHFR; CLDN1; RFC1; RFC4; HIST2H3C; HIST2H4A; MED12; MED24; ME
Blocking Peptide:
For anti-BRD4 (ARP39076_P050) antibody is Catalog # AAP39076 (Previous Catalog # AAPS05411)
Datasheets/Manuals:
Printable datasheet for anti-BRD4 (ARP39076_P050) antibody
Target Reference:
Schweiger,M.R., (2006) J. Virol. 80 (9), 4276-4285

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...