Size:100 ul
$319.00
In stock
SKU
ARP39076_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39076_P050-FITC Conjugated

ARP39076_P050-HRP Conjugated

ARP39076_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, IF, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-141740 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-BRD4 (ARP39076_P050)
Peptide Sequence Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BRD4 (ARP39076_P050) antibody is Catalog # AAP39076 (Previous Catalog # AAPS05411)
Datasheets/Manuals Printable datasheet for anti-BRD4 (ARP39076_P050) antibody
Target Reference Schweiger,M.R., (2006) J. Virol. 80 (9), 4276-4285
Gene Symbol BRD4
Official Gene Full Name Bromodomain containing 4
Alias Symbols CAP, HUNKI, MCAP, HUNK1
NCBI Gene Id 23476
Protein Name Bromodomain-containing protein 4
Description of Target BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
Swissprot Id O60885-2
Protein Accession # NP_055114
Nucleotide Accession # NM_014299
Protein Size (# AA) 722
Molecular Weight 80kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BRD4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BRD4.
Protein Interactions AFF1; CDK9; CCNT1; STAT3; JMJD6; TCERG1; HEXIM1; RN7SK; PRPF40A; vif; RPL6; MYC; MLLT1; ELAVL1; SUMO2; UBC; YWHAZ; KAT8; C8orf33; MESDC2; HIST1H4A; HIST1H3A; YWHAE; MED1; EP300; KDM5B; C7orf25; CHFR; CLDN1; RFC1; RFC4; HIST2H3C; HIST2H4A; MED12; MED24; ME
Write Your Own Review
You're reviewing:BRD4 Antibody - C-terminal region (ARP39076_P050)
Your Rating