Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BRCA1 Antibody - N-terminal region (AVARP02017_P050)

  • Catalog#: AVARP02017_P050
  • Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
Discontinued

Conjugation Options

AVARP02017_P050-FITC Conjugated

AVARP02017_P050-HRP Conjugated

AVARP02017_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
BRCA1
NCBI Gene Id:
672
Official Gene Full Name:
Breast cancer 1, early onset
Protein Name:
Breast cancer type 1 susceptibility protein
Swissprot Id:
P38398
Protein Accession #:
NP_009229
Nucleotide Accession #:
NM_007298
Alias Symbols:
IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53
Description of Target:
BRCA1, which functions as a tumor suppressor in human breast cancer cells, is a nuclear phosphoprotein which associates with RNA polymerase II holoenzyme. Mutations in BRCA1 are predicted to be responsible for approximately 45% of inherited breast cancer and more than 80% of inherited breast and ovarian cancer. BRCA1 may function as a transcriptional regulator, due to an amino terminal DNA-binding ring finger motif, nuclear localization signals, and an acidic carboxy terminal domain. BRCA1 is also a granin-like protein that functions as a secreted growth inhibitory protein. BRCA1 may normally serve as a negative regulator of mammary epithelial cell growth. This function is compromised in breast cancer either by direct mutation or by alterations in gene expression.
Protein Size (# AA):
680
Molecular Weight:
76kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRCA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRCA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BRCA1
Species Reactivity:
Dog, Human, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Human: 100%; Rat: 76%
Complete computational species homology data:
Anti-BRCA1 (AVARP02017_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RAD50; MED17; RAD51; YAP3; HDA3; SSN3; BEM4; GYP5; YAF9; HDAC2; MSH6; BAP1; SUPT5H; POLR2A; NPR1; NUP53; MET18; CDC21; MLP1; CTK1; MSH2; BACH1; DAN1; TMA22; BBC1; RPB4; SPT4; YGR053C; ATE1; YBP2; SLI15; RAD16; XRS2; RAD55; BUR2; BRIP1; ESR1; BECN1; HIST1H
Blocking Peptide:
For anti-BRCA1 (AVARP02017_P050) antibody is Catalog # AAP30434 (Previous Catalog # AAPP01017)
Datasheets/Manuals:
Printable datasheet for anti-BRCA1 (AVARP02017_P050) antibody
Sample Type Confirmation:

BRCA1 is supported by BioGPS gene expression data to be expressed in K562

Target Reference:
Mark,W.Y., et al., (2005) J. Mol. Biol. 345 (2), 275-287
Publications:

Kim, J.-H., Yu, C.-H., Yhee, J.-Y., Im, K.-S. & Sur, J.-H. Lymphocyte infiltration, expression of interleukin (IL) -1, IL-6 and expression of mutated breast cancer susceptibility gene-1 correlate with malignancy of canine mammary tumours. J. Comp. Pathol. 142, 177-86 IHC, WB, Dog, Human, Rat 19959182

Tell us what you think about this item!

Write A Review
    Please, wait...