Size:100 ul
Special Price $229.00 Regular Price $319.00
Discontinued
SKU
AVARP02017_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP02017_P050-FITC Conjugated

AVARP02017_P050-HRP Conjugated

AVARP02017_P050-Biotin Conjugated

BRCA1 Antibody - N-terminal region (AVARP02017_P050)

Catalog#: AVARP02017_P050
Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BRCA1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 92%; Human: 100%; Rat: 76%
Complete computational species homology data Anti-BRCA1 (AVARP02017_P050)
Peptide Sequence Synthetic peptide located within the following region: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BRCA1 (AVARP02017_P050) antibody is Catalog # AAP30434 (Previous Catalog # AAPP01017)
Datasheets/Manuals Printable datasheet for anti-BRCA1 (AVARP02017_P050) antibody
Sample Type Confirmation

BRCA1 is supported by BioGPS gene expression data to be expressed in K562

Target Reference Mark,W.Y., et al., (2005) J. Mol. Biol. 345 (2), 275-287
Publications

Kim, J.-H., Yu, C.-H., Yhee, J.-Y., Im, K.-S. & Sur, J.-H. Lymphocyte infiltration, expression of interleukin (IL) -1, IL-6 and expression of mutated breast cancer susceptibility gene-1 correlate with malignancy of canine mammary tumours. J. Comp. Pathol. 142, 177-86 (2010). IHC, WB, Dog, Human, Rat 19959182

Gene Symbol BRCA1
Official Gene Full Name Breast cancer 1, early onset
Alias Symbols IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53
NCBI Gene Id 672
Protein Name Breast cancer type 1 susceptibility protein
Description of Target BRCA1, which functions as a tumor suppressor in human breast cancer cells, is a nuclear phosphoprotein which associates with RNA polymerase II holoenzyme. Mutations in BRCA1 are predicted to be responsible for approximately 45% of inherited breast cancer and more than 80% of inherited breast and ovarian cancer. BRCA1 may function as a transcriptional regulator, due to an amino terminal DNA-binding ring finger motif, nuclear localization signals, and an acidic carboxy terminal domain. BRCA1 is also a granin-like protein that functions as a secreted growth inhibitory protein. BRCA1 may normally serve as a negative regulator of mammary epithelial cell growth. This function is compromised in breast cancer either by direct mutation or by alterations in gene expression.
Swissprot Id P38398
Protein Accession # NP_009229
Nucleotide Accession # NM_007298
Protein Size (# AA) 680
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BRCA1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BRCA1.
Protein Interactions RAD50; MED17; RAD51; YAP3; HDA3; SSN3; BEM4; GYP5; YAF9; HDAC2; MSH6; BAP1; SUPT5H; POLR2A; NPR1; NUP53; MET18; CDC21; MLP1; CTK1; MSH2; BACH1; DAN1; TMA22; BBC1; RPB4; SPT4; YGR053C; ATE1; YBP2; SLI15; RAD16; XRS2; RAD55; BUR2; BRIP1; ESR1; BECN1; HIST1H
  1. What is the species homology for "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Human, Rat".

  2. How long will it take to receive "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BRCA1 Antibody - N-terminal region (AVARP02017_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    This target may also be called "IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53" in publications.

  5. What is the shipping cost for "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "76kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BRCA1 Antibody - N-terminal region (AVARP02017_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BRCA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BRCA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BRCA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BRCA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BRCA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BRCA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BRCA1 Antibody - N-terminal region (AVARP02017_P050)
Your Rating
We found other products you might like!