Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP62762_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP62762_P050-FITC Conjugated

ARP62762_P050-HRP Conjugated

ARP62762_P050-Biotin Conjugated

BRAT1 Antibody - C-terminal region (ARP62762_P050)

Catalog#: ARP62762_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human BRAT1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-BRAT1 (ARP62762_P050)
Peptide SequenceSynthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-BRAT1 (ARP62762_P050) antibody is Catalog # AAP62762
Datasheets/ManualsPrintable datasheet for anti-BRAT1 (ARP62762_P050) antibody
Gene SymbolBRAT1
Official Gene Full NameBRCA1-associated ATM activator 1
Alias SymbolsMGC22916, BAAT1, C7orf27
NCBI Gene Id221927
Protein NameBRCA1-associated ATM activator 1
Description of TargetThe protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM.
Swissprot IdQ6PJG6
Protein Accession #NP_689956
Nucleotide Accession #NM_152743
Protein Size (# AA)821
Molecular Weight87kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BRAT1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BRAT1.
Protein InteractionsUBC; BRCA1; USP48; VCP; ATM; SUMO2;
Write Your Own Review
You're reviewing:BRAT1 Antibody - C-terminal region (ARP62762_P050)
Your Rating
Free Microscope
Aviva ChIP Antibodies
Aviva Blast Tool
Assay Development