Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP62762_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP62762_P050-FITC Conjugated

ARP62762_P050-HRP Conjugated

ARP62762_P050-Biotin Conjugated

BRAT1 Antibody - C-terminal region (ARP62762_P050)

Catalog#: ARP62762_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human BRAT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-BRAT1 (ARP62762_P050)
Peptide Sequence Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BRAT1 (ARP62762_P050) antibody is Catalog # AAP62762
Datasheets/Manuals Printable datasheet for anti-BRAT1 (ARP62762_P050) antibody
Gene Symbol BRAT1
Official Gene Full Name BRCA1-associated ATM activator 1
Alias Symbols MGC22916, BAAT1, C7orf27
NCBI Gene Id 221927
Protein Name BRCA1-associated ATM activator 1
Description of Target The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM.
Swissprot Id Q6PJG6
Protein Accession # NP_689956
Nucleotide Accession # NM_152743
Protein Size (# AA) 821
Molecular Weight 87kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BRAT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BRAT1.
Protein Interactions UBC; BRCA1; USP48; VCP; ATM; SUMO2;
  1. What is the species homology for "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BRAT1 Antibody - C-terminal region (ARP62762_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    This target may also be called "MGC22916, BAAT1, C7orf27" in publications.

  5. What is the shipping cost for "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "87kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BRAT1 Antibody - C-terminal region (ARP62762_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BRAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BRAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BRAT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BRAT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BRAT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BRAT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BRAT1 Antibody - C-terminal region (ARP62762_P050)
Your Rating