Search Antibody, Protein, and ELISA Kit Solutions

BRAT1 Antibody - C-terminal region (ARP62762_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62762_P050-FITC Conjugated

ARP62762_P050-HRP Conjugated

ARP62762_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
BRAT1
Official Gene Full Name:
BRCA1-associated ATM activator 1
NCBI Gene Id:
221927
Protein Name:
BRCA1-associated ATM activator 1
Swissprot Id:
Q6PJG6
Protein Accession #:
NP_689956
Nucleotide Accession #:
NM_152743
Alias Symbols:
MGC22916, BAAT1, C7orf27
Description of Target:
The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM.
Protein Size (# AA):
821
Molecular Weight:
87kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRAT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRAT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BRAT1
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-BRAT1 (ARP62762_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; BRCA1; USP48; VCP; ATM; SUMO2;
Blocking Peptide:
For anti-BRAT1 (ARP62762_P050) antibody is Catalog # AAP62762
Datasheets/Manuals:
Printable datasheet for anti-BRAT1 (ARP62762_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...