BPY2 Antibody - C-terminal region (ARP64756_P050)

Catalog No: ARP64756_P050

WB Suggested Anti-BPY2 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BPY2 (ARP64756_P050) antibody is Catalog # AAP64756

Target Info

• Gene Symbol: BPY2
• Gene Full Name: Basic charge, Y-linked, 2
• Alias Symbols: VCY2, BPY2A, VCY2A
• NCBI Gene Id: 9083
• Protein Name: Testis-specific basic protein Y 2
• Description of Target: This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the copy outside of the palidromic region.
• Uniprot ID: O14599
• Protein Accession #: NP_004669
• Nucleotide Accession #: NM_004678
• Protein Size (# AA): 106
• Molecular Weight: 12kDa
• Protein Interactions: UBE3A; MAP1S;