BPNT1 Antibody - N-terminal region : HRP (ARP58597_P050-HRP)

Catalog No: ARP58597_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BPNT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BPNT1 (ARP58597_P050-HRP) antibody is Catalog # AAP58597 (Previous Catalog # AAPP35814)
• Reference: Spiegelberg,B.D., (1999) J. Biol. Chem. 274 (19), 13619-13628

Target Info

• Gene Symbol: BPNT1
• Gene Full Name: 3'(2'), 5'-bisphosphate nucleotidase 1
• Alias Symbols: PIP, HEL20
• NCBI Gene Id: 10380
• Protein Name: 3'(2'),5'-bisphosphate nucleotidase 1
• Description of Target: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
• Uniprot ID: O95861
• Protein Accession #: NP_006076
• Nucleotide Accession #: NM_006085
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: SUMO2; UBC; IQCB1;