BPNT1 Antibody - N-terminal region (ARP58597_P050)

Catalog No: ARP58597_P050

WB Suggested Anti-BPNT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BPNT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BPNT1 (ARP58597_P050) antibody is Catalog # AAP58597 (Previous Catalog # AAPP35814)
• Reference: Spiegelberg,B.D., (1999) J. Biol. Chem. 274 (19), 13619-13628

Target Info

• Gene Symbol: BPNT1
• Gene Full Name: 3'(2'), 5'-bisphosphate nucleotidase 1
• Alias Symbols: PIP, HEL20
• NCBI Gene Id: 10380
• Protein Name: 3'(2'),5'-bisphosphate nucleotidase 1
• Description of Target: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
• Uniprot ID: O95861
• Protein Accession #: NP_006076
• Nucleotide Accession #: NM_006085
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: SUMO2; UBC; IQCB1;