BOK Antibody - middle region (ARP89124_P050)

Catalog No: ARP89124_P050

Host: Rabbit
Target Name: BOK
Sample Tissue: Mouse Thymus lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse BOK
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: CLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BOK (ARP89124_P050) antibody is Catalog # AAP89124

Target Info

• Gene Symbol: BOK
• Gene Full Name: BCL2-related ovarian killer
• Alias Symbols: mat, mtd, matador
• NCBI Gene Id: 51800
• Protein Name: bcl-2-related ovarian killer protein
• Description of Target: Apoptosis regulator that functions through different apoptotic signaling pathways. Plays a roles as pro-apoptotic protein that positively regulates intrinsic apoptotic process in a BAX- and BAK1-dependent manner or in a BAX- and BAK1-independent manner. In response to endoplasmic reticulum stress promotes mitochondrial apoptosis through downstream BAX/BAK1 activation and positive regulation of PERK-mediated unfolded protein response. Activates apoptosis independently of heterodimerization with survival-promoting BCL2 and BCL2L1 through induction of mitochondrial outer membrane permeabilization, in a BAX- and BAK1-independent manner, in response to inhibition of ERAD-proteasome degradation system, resulting in cytochrome c release. In response to DNA damage, mediates intrinsic apoptotic process in a TP53-dependent manner. Plays a role in granulosa cell apoptosis by CASP3 activation (By similarity). Plays a roles as anti-apoptotic protein during neuronal apoptotic process, by negatively regulating poly ADP-ribose polymerase-dependent cell death through regulation of neuronal calcium homeostasis and mitochondrial bioenergetics in response to NMDA excitation. In addition to its role in apoptosis, may regulate trophoblast cell proliferation during the early stages of placental development, by acting on G1/S transition through regulation of CCNE1 expression.May also play a role as an inducer of autophagy by disrupting interaction between MCL1 and BECN1 (By similarity).
• Uniprot ID: O35425
• Protein Accession #: NP_058058.1
• Nucleotide Accession #: NM_016778.3
• Protein Size (# AA): 213
• Molecular Weight: 23 kDa