Search Antibody, Protein, and ELISA Kit Solutions

BOD1 Antibody (ARP66324_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP66324_P050-FITC Conjugated

ARP66324_P050-HRP Conjugated

ARP66324_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
BOD1
Official Gene Full Name:
biorientation of chromosomes in cell division 1
NCBI Gene Id:
91272
Protein Name:
Biorientation of chromosomes in cell division protein 1
Swissprot Id:
Q96IK1
Protein Accession #:
NP_612378
Nucleotide Accession #:
NM_001159651
Alias Symbols:
FAM44B,
Protein Size (# AA):
185
Molecular Weight:
19 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BOD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BOD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence VVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 93%
Complete computational species homology data:
Anti-BOD1 (ARP66324_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; APP;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-BOD1 (ARP66324_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...