Search Antibody, Protein, and ELISA Kit Solutions

Bnc1 Antibody - C-terminal region (ARP33283_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33283_P050-FITC Conjugated

ARP33283_P050-HRP Conjugated

ARP33283_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Basonuclin 1
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AI047752, AW546376, Bnc
Description of Target:
The function of Bnc1 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Bnc1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Bnc1.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Bnc1 (ARP33283_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Pmaip1; Bcl2l11; Bmf;
Blocking Peptide:
For anti-Bnc1 (ARP33283_P050) antibody is Catalog # AAP33283 (Previous Catalog # AAPP04325)
Printable datasheet for anti-Bnc1 (ARP33283_P050) antibody

Feuerborn, A., Mathow, D., Srivastava, P. K., Gretz, N. & Gröne, H.-J. Basonuclin-1 modulates epithelial plasticity and TGF-b1-induced loss of epithelial cell integrity. Oncogene. 34, 1185-95 (2015). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24662832

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...