Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP33283_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33283_P050-FITC Conjugated

ARP33283_P050-HRP Conjugated

ARP33283_P050-Biotin Conjugated

Bnc1 Antibody - C-terminal region (ARP33283_P050)

Catalog#: ARP33283_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-Bnc1 (ARP33283_P050)
Peptide Sequence Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Bnc1 (ARP33283_P050) antibody is Catalog # AAP33283 (Previous Catalog # AAPP04325)
Datasheets/Manuals Printable datasheet for anti-Bnc1 (ARP33283_P050) antibody
Publications

Feuerborn, A., Mathow, D., Srivastava, P. K., Gretz, N. & Gröne, H.-J. Basonuclin-1 modulates epithelial plasticity and TGF-b1-induced loss of epithelial cell integrity. Oncogene. 34, 1185-95 (2015). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24662832

Gene Symbol Bnc1
Official Gene Full Name Basonuclin 1
Alias Symbols AI047752, AW546376, Bnc
NCBI Gene Id 12173
Description of Target The function of Bnc1 remains unknown.
Swissprot Id O35914
Protein Accession # NP_031588
Nucleotide Accession # NM_007562
Protein Size (# AA) 990
Molecular Weight 110kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Bnc1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Bnc1.
Protein Interactions Pmaip1; Bcl2l11; Bmf;
  1. What is the species homology for "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Bnc1 Antibody - C-terminal region (ARP33283_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    This target may also be called "AI047752, AW546376, Bnc" in publications.

  5. What is the shipping cost for "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Bnc1 Antibody - C-terminal region (ARP33283_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BNC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BNC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BNC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BNC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BNC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BNC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Bnc1 Antibody - C-terminal region (ARP33283_P050)
Your Rating
We found other products you might like!