BMP8A Antibody - middle region (ARP65413_P050)

Catalog No: ARP65413_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: BMP8A
Sample Tissue: Human large intestine Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BMP8A
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: FFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BMP8A (ARP65413_P050) antibody is Catalog # AAP65413

Target Info

• Gene Symbol: BMP8A
• Gene Full Name: bone morphogenetic protein 8a
• Alias Symbols: OP-2
• NCBI Gene Id: 353500
• Protein Name: bone morphogenetic protein 8A
• Description of Target: This gene encodes a member of the transforming growth factor beta superfamily of regulatory proteins. The encoded preproprotein undergoes proteolytic processing to generate the mature protein. Studies in laboratory mice suggest that this protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1.
• Uniprot ID: Q7Z5Y6
• Protein Accession #: NP_861525
• Nucleotide Accession #: NM_181809.3
• Protein Size (# AA): 402
• Molecular Weight: 44 kDa
• Protein Interactions: Dlg4;