Search Antibody, Protein, and ELISA Kit Solutions

BMP4 Antibody - C-terminal region (ARP63062_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63062_P050-FITC Conjugated

ARP63062_P050-HRP Conjugated

ARP63062_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
BMP4
Official Gene Full Name:
Bone morphogenetic protein 4
NCBI Gene Id:
652
Protein Name:
Bone morphogenetic protein 4
Swissprot Id:
P12644
Protein Accession #:
NP_001193
Nucleotide Accession #:
NM_001202
Alias Symbols:
BMP2B, BMP2B1, MCOPS6, OFC11, ZYME
Replacement Item:
This antibody may replace item sc-12721 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Protein Size (# AA):
408
Molecular Weight:
46kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BMP4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BMP4.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-BMP4 (ARP63062_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BMPR2; ZFYVE9; UBC; BGN; GREM2; BMPER; SOSTDC1; CHRDL2; STAP2; BMPR1B; NOG; BMP8B; HTRA1; BMPR1A; CHRDL1; BMP4; TWSG1; CHRD;
Blocking Peptide:
For anti-BMP4 (ARP63062_P050) antibody is Catalog # AAP63062
Datasheets/Manuals:
Printable datasheet for anti-BMP4 (ARP63062_P050) antibody
Publications:

Ganti, R., Hunt, R. C., Parapuram, S. K. & Hunt, D. M. Vitreous modulation of gene expression in low-passage human retinal pigment epithelial cells. Invest. Ophthalmol. Vis. Sci. 48, 1853-63 (2007). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 17389521

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...