Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63062_P050-FITC Conjugated

ARP63062_P050-HRP Conjugated

ARP63062_P050-Biotin Conjugated

BMP4 Antibody - C-terminal region (ARP63062_P050)

Catalog#: ARP63062_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12721 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-BMP4 (ARP63062_P050)
Peptide Sequence Synthetic peptide located within the following region: NWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BMP4 (ARP63062_P050) antibody is Catalog # AAP63062
Datasheets/Manuals Printable datasheet for anti-BMP4 (ARP63062_P050) antibody

Ganti, R., Hunt, R. C., Parapuram, S. K. & Hunt, D. M. Vitreous modulation of gene expression in low-passage human retinal pigment epithelial cells. Invest. Ophthalmol. Vis. Sci. 48, 1853-63 (2007). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 17389521

Gene Symbol BMP4
Official Gene Full Name Bone morphogenetic protein 4
Alias Symbols BMP2B, BMP2B1, MCOPS6, OFC11, ZYME
NCBI Gene Id 652
Protein Name Bone morphogenetic protein 4
Description of Target The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Swissprot Id P12644
Protein Accession # NP_001193
Nucleotide Accession # NM_001202
Protein Size (# AA) 408
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BMP4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BMP4.
Write Your Own Review
You're reviewing:BMP4 Antibody - C-terminal region (ARP63062_P050)
Your Rating