Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP63062_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63062_P050-FITC Conjugated

ARP63062_P050-HRP Conjugated

ARP63062_P050-Biotin Conjugated

BMP4 Antibody - C-terminal region (ARP63062_P050)

Catalog#: ARP63062_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12721 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-BMP4 (ARP63062_P050)
Peptide Sequence Synthetic peptide located within the following region: NWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BMP4 (ARP63062_P050) antibody is Catalog # AAP63062
Datasheets/Manuals Printable datasheet for anti-BMP4 (ARP63062_P050) antibody
Publications

Ganti, R., Hunt, R. C., Parapuram, S. K. & Hunt, D. M. Vitreous modulation of gene expression in low-passage human retinal pigment epithelial cells. Invest. Ophthalmol. Vis. Sci. 48, 1853-63 (2007). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 17389521

Gene Symbol BMP4
Official Gene Full Name Bone morphogenetic protein 4
Alias Symbols BMP2B, BMP2B1, MCOPS6, OFC11, ZYME
NCBI Gene Id 652
Protein Name Bone morphogenetic protein 4
Description of Target The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Swissprot Id P12644
Protein Accession # NP_001193
Nucleotide Accession # NM_001202
Protein Size (# AA) 408
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BMP4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BMP4.
Protein Interactions BMPR2; ZFYVE9; UBC; BGN; GREM2; BMPER; SOSTDC1; CHRDL2; STAP2; BMPR1B; NOG; BMP8B; HTRA1; BMPR1A; CHRDL1; BMP4; TWSG1; CHRD;
  1. What is the species homology for "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BMP4 Antibody - C-terminal region (ARP63062_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    This target may also be called "BMP2B, BMP2B1, MCOPS6, OFC11, ZYME" in publications.

  5. What is the shipping cost for "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BMP4 Antibody - C-terminal region (ARP63062_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BMP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BMP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BMP4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BMP4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BMP4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BMP4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BMP4 Antibody - C-terminal region (ARP63062_P050)
Your Rating
We found other products you might like!